This commit consolidates a large set of host-mode security and UX fixes across backend and frontend. Security / execution model: - Make permission/execution mode switches apply immediately (no deferred pending-only behavior). - Keep runtime mode change notices durable and visible via user-message guidance path. - Add explicit runtime message source taxonomy support and persistence: user / presend / guidance / notify / sub_agent / background_command. - Ensure guidance/notify insertion is batched per tool-cycle so mid-run inserts are committed together. - Separate notify from guidance semantics for mode-change notices. - Add direct-mode auto-fallback handling visibility on frontend. Approval and command gating: - Align run_command approval pre-check logic with docker behavior for approval/auto_approval modes in host execution paths. - Keep approval retry flow and final-result semantics intact when permission errors trigger approval. - Externalize forbidden command keyword list into JSON config: config/forbidden_commands.json. - Update forbidden command rejection message to user-facing wording: 用户不允许执行包含“... ”的指令. Prompt/runtime guidance: - Refine execution-mode runtime rule text to avoid endless workaround loops: one safe alternative first, then request switching to direct mode when truly required. Chat rendering / message UX: - Prevent injected guidance/notify user-messages from incorrectly triggering assistant work header/timer chain. - Restore correct visibility after history reload while preserving runtime-source behavior. - Update user-header icon/label rendering by message source: - guidance -> 引导 + navigation icon - notify/sub_agent/background_command -> 通知 + bell icon - user/presend -> keep normal user header. - Add new icons: static/icons/navigation.svg, static/icons/bell.svg. Approval panel UX: - Convert desktop approval panel from layout-compress sidebar to overlay + blur sheet. - Fix panel transition behavior (remove unintended vertical motion; use dedicated desktop overlay transition). - Improve approval result display: - decision and reason split lines, - green/red status styling, - multiline reason rendering, - auto-collapse delay adjusted to 3s. Execution mode TTL feedback: - When direct mode auto-expires to sandbox, frontend menu state is updated from status snapshot. - Show non-auto-dismiss warning toast to explicitly notify auto-fallback. Misc consistency updates: - Execution mode label text cleanup in composer. - Runtime notice wording normalization (权限模式修改为..., 执行环境修改为...). Build/test notes: - Frontend rebuilt after UI changes. - Smoke tests passed for server refactor path.
779 lines
41 KiB
Plaintext
779 lines
41 KiB
Plaintext
【翻译前 - 英文原文】
|
||
|
||
================================================================================
|
||
1 ABSTRACT
|
||
================================================================================
|
||
While large language models (LLMs) have demonstrated impressive performance
|
||
across tasks in language understanding and interactive decision making, their
|
||
abilities for reasoning (e.g. chain-of-thought prompting) and acting (e.g. action
|
||
plan generation) have primarily been studied as separate topics. In this paper, we
|
||
explore the use of LLMs to generate both reasoning traces and task-specific actions
|
||
in an interleaved manner, allowing for greater synergy between the two: reasoning
|
||
traces help the model induce, track, and update action plans as well as handle
|
||
exceptions, while actions allow it to interface with and gather additional information
|
||
from external sources such as knowledge bases or environments. We apply our
|
||
approach, named ReAct, to a diverse set of language and decision making tasks
|
||
and demonstrate its effectiveness over state-of-the-art baselines in addition to
|
||
improved human interpretability and trustworthiness. Concretely, on question
|
||
answering (HotpotQA) and fact verification (Fever), ReAct overcomes prevalent
|
||
issues of hallucination and error propagation in chain-of-thought reasoning by
|
||
interacting with a simple Wikipedia API, and generating human-like task-solving
|
||
trajectories that are more interpretable than baselines without reasoning traces.
|
||
Furthermore, on two interactive decision making benchmarks (ALFWorld and
|
||
WebShop), ReAct outperforms imitation and reinforcement learning methods by
|
||
an absolute success rate of 34% and 10% respectively, while being prompted with
|
||
only one or two in-context examples.
|
||
|
||
================================================================================
|
||
2 INTRODUCTION
|
||
================================================================================
|
||
A unique feature of human intelligence is the ability to seamlessly combine task-oriented actions with
|
||
verbal reasoning (or inner speech, Alderson-Day & Fernyhough, 2015), which has been theorized to
|
||
play an important role in human cognition for enabling self-regulation or strategization (Vygotsky,
|
||
1987; Luria, 1965; Fernyhough, 2010) and maintaining a working memory (Baddeley, 1992). Con-
|
||
sider the example of cooking up a dish in the kitchen. Between any two specific actions, we may
|
||
reason in language in order to track progress (“now that everything is cut, I should heat up the pot of
|
||
water”), to handle exceptions or adjust the plan according to the situation (“I don’t have salt, so let
|
||
me use soy sauce and pepper instead”), and to realize when external information is needed (“how do
|
||
I prepare dough? Let me search on the Internet”). We may also act (open a cookbook to read the
|
||
recipe, open the fridge, check ingredients) to support the reasoning and to answer questions (“What
|
||
dish can I make right now?”). This tight synergy between “acting” and “reasoning” allows humans
|
||
to learn new tasks quickly and perform robust decision making or reasoning, even under previously
|
||
unseen circumstances or facing information uncertainties.
|
||
Recent results have hinted at the possibility of combining verbal reasoning with interactive decision
|
||
making in autonomous systems. On one hand, properly prompted large language models (LLMs)
|
||
have demonstrated emergent capabilities to carry out several steps of reasoning traces to derive
|
||
∗Work during Google internship. Projet page with code: https://react-lm.github.io/.
|
||
arXiv:2210.03629v3 [cs.CL] 10 Mar 2023
|
||
|
||
--- Page 2 ---
|
||
$FW7KLQN>)LUVW,QHHGWRILQGDSHSSHUVKDNHUPRUH
|
||
OLNHO\WRDSSHDULQFDELQHWVFRXQWHUWRSV
|
||
@
|
||
$FW*RWRFDELQHW
|
||
2EV2QWKHFDELQHW\RXVHHDYDVH
|
||
+HUHWKHDJHQWJRWRFDELQHWWKHQFDELQHWWKHQFRXQWHUWRSDQG
|
||
$FW*RWRFRXQWHUWRS
|
||
2EV2QWKHFRXQWHUWRS\RXVHHDDSSOHDEUHDG
|
||
|
||
DSHSSHUVKDNHUDQGDYDVH
|
||
$FW7DNHSHSSHUVKDNHUIURPFRXQWHUWRS
|
||
2EV<RXSLFNXSWKHSHSSHUVKDNHUIURPWKHFRXQWHUWRS
|
||
|
||
$FW7KLQN>1RZ,ILQGDSHSSHUVKDNHU1H[W,QHHGWR
|
||
|
||
SXWLWLQRQGUDZHU @
|
||
$FW*RWRGUDZHU
|
||
2EV'UDZHULVFORVHG
|
||
$FW2SHQGUDZHU
|
||
2EV<RXRSHQ'UDZHUª
|
||
$FW3XWSHSSHUVKDNHULQRQGUDZHU
|
||
2EV<RXSXWSHSSHUVKDNHULQRQWKHGUDZHU
|
||
D6WDQGDUG
|
||
$QVZHUL3RG
|
||
E&R75HDVRQ2QO\
|
||
7KRXJKW/HW
|
||
VWKLQNVWHS
|
||
E\VWHS $SSOH5HPRWHZDV
|
||
RULJLQDOO\GHVLJQHGWR
|
||
LQWHUDFWZLWK$SSOH79
|
||
$SSOH79FDQEHFRQWUROOHG
|
||
E\L3KRQHL3DGDQGL3RG
|
||
7RXFK6RWKHDQVZHULV
|
||
L3KRQHL3DGDQGL3RG
|
||
7RXFK
|
||
$QVZHUL3KRQHL3DGL3RG
|
||
7RXFK
|
||
F$FW2QO\
|
||
$FW6HDUFK>$SSOH5HPRWH@
|
||
2EV7KH$SSOH5HPRWHLV D
|
||
UHPRWHFRQWUROª
|
||
$FW6HDUFK>)URQW5RZ @
|
||
2EV&RXOGQRWILQG>)URQW
|
||
5RZ@6LPLODUª
|
||
$FW6HDUFK>)URQW5RZ
|
||
VRIWZDUH @
|
||
2EV)URQW5RZLVD
|
||
GLVFRQWLQXHGPHGLDFHQWHU
|
||
VRIWZDUHª
|
||
$FW)LQLVK>\HV@
|
||
G5H$FW5HDVRQ$FW
|
||
7KRXJKW,QHHGWRVHDUFK$SSOH5HPRWHDQGILQGWKH
|
||
SURJUDPLWZDVRULJLQDOO\GHVLJQHGWRLQWHUDFWZLWK
|
||
$FW6HDUFK>$SSOH5HPRWH@
|
||
2EV7KH$SSOH5HPRWHLVDUHPRWHFRQWUROLQWURGXFHGLQ
|
||
|
||
2FWREHUE\$SSOHªRULJLQDOO\GHVLJQHGWRFRQWUROWKH
|
||
|
||
)URQW5RZPHGLDFHQWHU SURJUDPª
|
||
7KRXJKW$SSOH5HPRWHZDVRULJLQDOO\GHVLJQHGWRFRQWURO
|
||
|
||
WKH)URQW5RZPHGLDFHQWHUSURJUDP,QHHGWRVHDUFK
|
||
)URQW
|
||
5RZQH[WDQGILQGZKDWRWKHUGHYLFHFDQFRQWUROLW
|
||
$FW6HDUFK>)URQW5RZ@
|
||
2EV&RXOGQRWILQG>)URQW5RZ@6LPLODU>
|
||
)URQW5RZ
|
||
|
||
6HDWWR(DUWK
|
||
|
||
)URQW5RZ0RWRUVSRUWV
|
||
|
||
)URQW5RZ
|
||
VRIWZDUH
|
||
ª@
|
||
7KRXJKW)URQW5RZLVQRWIRXQG,QHHGWRVHDUFK )URQW
|
||
5RZVRIWZDUH
|
||
$FW6HDUFK>)URQW5RZVRIWZDUH @
|
||
2EV)URQW5RZLVDGLVFRQWLQXHGPHGLDFHQWHUVRIWZDUHª
|
||
7KRXJKW)URQW5RZVRIWZDUHLVFRQWUROOHGE\DQ$SSOH
|
||
|
||
5HPRWHRUWKHNH\ERDUGIXQFWLRQNH\V 6RWKHDQVZHULV
|
||
NH\ERDUGIXQFWLRQNH\V
|
||
$FW)LQLVK>NH\ERDUGIXQFWLRQNH\V @
|
||
Ҽ
|
||
4XHVWLRQ$VLGHIURPWKH$SSOH5HPRWHZKDWRWKHUGHYLFH
|
||
|
||
FDQFRQWUROWKHSURJUDP$SSOH5HPRWHZDVRULJLQDOO\
|
||
|
||
GHVLJQHGWRLQWHUDFWZLWK"
|
||
D$FW2QO\
|
||
$FW*RWRGUDZHU
|
||
2EV7KHGUDZHULVFORVHG
|
||
$FW2SHQGUDZHU
|
||
2EV<RXRSHQWKHGUDZHU7KHGUDZHULVRSHQ,QLW
|
||
|
||
\RXVHHDGLVKVSRQJHDQGDVSRRQ
|
||
|
||
$FW*RWRVLQNEDVLQ
|
||
2EV2QWKHVLQNEDVLQ\RXVHHDGLVKVSRQJHD
|
||
|
||
VSDWXODDQGDVSRRQ
|
||
$FW7DNHSHSSHUVKDNHUIURPVLQNEDVLQ
|
||
2EV1RWKLQJKDSSHQV
|
||
$FW7DNHSHSSHUVKDNHUIURPVLQNEDVLQ
|
||
2EV1RWKLQJKDSSHQV
|
||
E5H$FW5HDVRQ$FW
|
||
Ҽ
|
||
<RXDUHLQWKHPLGGOHRIDURRP/RRNLQJTXLFNO\DURXQG
|
||
|
||
\RX\RXVHHDFDELQHWDFDELQHWDFRIIHHPDFKLQH
|
||
|
||
DFRXQWHUWRSDVWRYHEXUQHUDQGDWRDVWHU
|
||
|
||
<RXUWDVNLVWR3XWVRPHSHSSHUVKDNHURQDGUDZHU
|
||
$OI:RUOG
|
||
+RWVSRW4$
|
||
Figure 1: (1) Comparison of 4 prompting methods, (a) Standard, (b) Chain-of-thought (CoT,
|
||
Reason Only), (c) Act-only, and (d) ReAct (Reason+Act), solving a HotpotQA (Yang et al., 2018)
|
||
question. (2) Comparison of (a) Act-only and (b) ReAct prompting to solve an AlfWorld (Shridhar
|
||
et al., 2020b) game. In both domains, we omit in-context examples in the prompt, and only show task
|
||
solving trajectories generated by the model (Act, Thought) and the environment (Obs).
|
||
answers from questions in arithmetic, commonsense, and symbolic reasoning tasks (Wei et al.,
|
||
2022). However, this “chain-of-thought” reasoning is a static black box, in that the model uses
|
||
its own internal representations to generate thoughts and is not grounded in the external world,
|
||
which limits its ability to reason reactively or update its knowledge. This can lead to issues like fact
|
||
hallucination and error propagation over the reasoning process (Figure 1 (1b)). On the other hand,
|
||
recent work has explored the use of pre-trained language models for planning and acting in interactive
|
||
environments (Ahn et al., 2022; Nakano et al., 2021; Yao et al., 2020; Huang et al., 2022a), with
|
||
a focus on predicting actions via language priors. These approaches usually convert multi-modal
|
||
observations into text, use a language model to generate domain-specific actions or plans, and then
|
||
use a controller to choose or execute them. However, they do not employ language models to reason
|
||
abstractly about high-level goals or maintain a working memory to support acting, barring Huang
|
||
et al. (2022b) who perform a limited form of verbal reasoning to reiterate spatial facts about the
|
||
current state. Beyond such simple embodied tasks to interact with a few blocks, there have not been
|
||
studies on how reasoning and acting can be combined in a synergistic manner for general task solving,
|
||
and if such a combination can bring systematic benefits compared to reasoning or acting alone.
|
||
In this work, we present ReAct, a general paradigm to combine reasoning and acting with language
|
||
models for solving diverse language reasoning and decision making tasks (Figure 1). ReAct
|
||
prompts LLMs to generate both verbal reasoning traces and actions pertaining to a task in an
|
||
interleaved manner, which allows the model to perform dynamic reasoning to create, maintain, and
|
||
adjust high-level plans for acting (reason to act), while also interact with the external environments
|
||
(e.g. Wikipedia) to incorporate additional information into reasoning (act to reason).
|
||
|
||
--- Page 3 ---
|
||
We conduct empirical evaluations of ReAct and state-of-the-art baselines on four diverse benchmarks:
|
||
question answering (HotPotQA, Yang et al., 2018), fact verification (Fever, Thorne et al., 2018),
|
||
text-based game (ALFWorld, Shridhar et al., 2020b), and webpage navigation (WebShop, Yao
|
||
et al., 2022). For HotPotQA and Fever, with access to a Wikipedia API that the model can interact
|
||
with, ReAct outperforms vanilla action generation models while being competitive with chain-of-
|
||
thought reasoning (CoT) (Wei et al., 2022). The best approach overall is a combination of ReAct
|
||
and CoT that allows for the use of both internal knowledge and externally obtained information
|
||
during reasoning. On ALFWorld and WebShop, two or even one-shot ReAct prompting is able
|
||
to outperform imitation or reinforcement learning methods trained with 103 ∼105 task instances,
|
||
with an absolute improvement of 34% and 10% in success rates respectively. We also demonstrate
|
||
the importance of sparse, versatile reasoning in decision making by showing consistent advantages
|
||
over controlled baselines with actions only. Besides general applicability and performance boost,
|
||
the combination of reasoning and acting also contributes to model interpretability, trustworthiness,
|
||
and diagnosability across all domains, as humans can readily distinguish information from model’s
|
||
internal knowledge versus external environments, as well as inspect reasoning traces to understand
|
||
the decision basis of model actions.
|
||
To summarize, our key contributions are the following: (1) we introduce ReAct, a novel prompt-
|
||
based paradigm to synergize reasoning and acting in language models for general task solving; (2) we
|
||
perform extensive experiments across diverse benchmarks to showcase the advantage of ReAct in a
|
||
few-shot learning setup over prior approaches that perform either reasoning or action generation in
|
||
isolation; (3) we present systematic ablations and analysis to understand the importance of acting in
|
||
reasoning tasks, and reasoning in interactive tasks; (4) we analyze the limitations of ReAct under the
|
||
prompting setup (i.e. limited support of reasoning and acting behaviors), and perform initial finetuning
|
||
experiments showing the potential of ReAct to improve with additional training data. Scaling up
|
||
ReAct to train and operate on more tasks and combining it with complementary paradigms like
|
||
reinforcement learning could further unlock the potential of large language models.
|
||
REAC T: SYNERGIZING REASONING + ACTING
|
||
Consider a general setup of an agent interacting with an environment for task solving. At time
|
||
step t, an agent receives an observation ot ∈O from the environment and takes an action at ∈A
|
||
following some policy π(at|ct), where ct = (o1, a1, · · · , ot−1, at−1, ot) is the context to the agent.
|
||
Learning a policy is challenging when the mapping ct 7→at is highly implicit and requires extensive
|
||
computation. For example, the agent shown in Figure 1(1c) is unable to generate the correct final
|
||
action (Act 4) to finish the QA task as it requires complex reasoning over the trajectory context
|
||
(Question, Act 1-3, Obs 1-3). Similarly, the agent shown in Figure 1(2a) fails to comprehend from the
|
||
context that sinkbasin 1 does not contain peppershaker 1, thus keep producing hallucinating actions.
|
||
The idea of ReAct is simple: we augment the agent’s action space to ˆ
|
||
A = A ∪L, where L is the
|
||
space of language. An action ˆat ∈L in the language space, which we will refer to as a thought or a
|
||
reasoning trace, does not affect the external environment, thus leading to no observation feedback.
|
||
Instead, a thought ˆat aims to compose useful information by reasoning over the current context ct,
|
||
and update the context ct+1 = (ct, ˆat) to support future reasoning or acting. As shown in Figure 1,
|
||
there could be various types of useful thoughts, e.g. decomposing task goals and create action plans
|
||
(2b, Act 1; 1d, Thought 1), injecting commonsense knowledge relevant to task solving (2b, Act 1),
|
||
extracting important parts from observations (1d, Thought2, 4), track progress and transit action plans
|
||
(2b, Act 8), handle exceptions and adjust action plans (1d, Thought 3), and so on.
|
||
However, as the language space L is unlimited, learning in this augmented action space is difficult
|
||
and requires strong language priors. In this paper, we mainly focus on the setup where a frozen
|
||
large language model, PaLM-540B (Chowdhery et al., 2022)1, is prompted with few-shot in-context
|
||
examples to generate both domain-specific actions and free-form language thoughts for task solving
|
||
(Figure 1 (1d), (2b)). Each in-context example is a human trajectory of actions, thoughts, and
|
||
environment observations to solve a task instance (see Appendix C). For the tasks where reasoning is
|
||
of primary importance (Figure 1(1)), we alternate the generation of thoughts and actions so that the
|
||
task-solving trajectory consists of multiple thought-action-observation steps. In contrast, for decision
|
||
making tasks that potentially involve a large number of actions (Figure 1(2)), thoughts only need to
|
||
1We show some GPT-3 (Brown et al., 2020) results in Appendix A.1, which outperforms PaLM-540B.
|
||
|
||
--- Page 4 ---
|
||
appear sparsely in the most relevant positions of a trajectory, so we let the language model decide the
|
||
asynchronous occurrence of thoughts and actions for itself.
|
||
Since decision making and reasoning capabilities are integrated into a large language model, ReAct
|
||
enjoys several unique features: A) Intuitive and easy to design: Designing ReAct prompts is
|
||
straightforward as human annotators just type down their thoughts in language on top of their actions
|
||
taken. No ad-hoc format choice, thought design, or example selection is used in this paper. We detail
|
||
prompt design for each task in Sections 3 and 4. B) General and flexible: Due to the flexible thought
|
||
space and thought-action occurrence format, ReAct works for diverse tasks with distinct action
|
||
spaces and reasoning needs, including but not limited to QA, fact verification, text game, and web
|
||
navigation. C) Performant and robust: ReAct shows strong generalization to new task instances
|
||
while learning solely from one to six in-context examples, consistently outperforming baselines with
|
||
only reasoning or acting across different domains. We also show in Section 3 additional benefits
|
||
when finetuning is enabled, and in Section 4 how ReAct performance is robust to prompt selections.
|
||
D) Human aligned and controllable: ReAct promises an interpretable sequential decision making
|
||
and reasoning process where humans can easily inspect reasoning and factual correctness. Moreover,
|
||
humans can also control or correct the agent behavior on the go by thought editing, as shown in
|
||
Figure 5 in Section 4.
|
||
KNOWLEDGE-INTENSIVE REASONING TASKS
|
||
We begin with knowledge-intensive reasoning tasks like multi-hop question answering and fact
|
||
verification. As shown in Figure 1(1d), by interacting with a Wikipedia API, ReAct is able to
|
||
retrieve information to support reasoning, while also use reasoning to target what to retrieve next,
|
||
demonstrating a synergy of reasoning and acting.
|
||
3.1
|
||
SETUP
|
||
Domains
|
||
We consider two datasets challenging knowledge retrieval and reasoning: (1) Hot-
|
||
PotQA (Yang et al., 2018), a multi-hop question answering benchmark that requires reasoning
|
||
over two or more Wikipedia passages, and (2) FEVER (Thorne et al., 2018), a fact verification
|
||
benchmark where each claim is annotated SUPPORTS, REFUTES, or NOT ENOUGH INFO, based
|
||
on if there exists a Wikipedia passage to verify the claim. In this work, we operate in a question-only
|
||
setup for both tasks, where models only receive the question/claim as input without access to support
|
||
paragraphs, and have to rely on their internal knowledge or retrieve knowledge via interacting with
|
||
an external environment to support reasoning.
|
||
Action Space
|
||
We design a simple Wikipedia web API with three types of actions to support
|
||
interactive information retrieval: (1) search[entity], which returns the first 5 sentences from
|
||
the corresponding entity wiki page if it exists, or else suggests top-5 similar entities from the
|
||
Wikipedia search engine, (2) lookup[string], which would return the next sentence in the page
|
||
containing string, simulating Ctrl+F functionality on the browser. (3) finish[answer], which
|
||
would finish the current task with answer. We note that this action space mostly can only retrieve a
|
||
small part of a passage based on exact passage name, which is significantly weaker than state-of-the-
|
||
art lexical or neural retrievers. The purpose is to simulate how humans would interact with Wikipedia,
|
||
and force models to retrieve via explicit reasoning in language.
|
||
3.2
|
||
|
||
================================================================================
|
||
3 METHOD
|
||
================================================================================
|
||
S
|
||
ReAct Prompting
|
||
For HotpotQA and Fever, we randomly select 6 and 3 cases2 from the training
|
||
set and manually compose ReAct-format trajectories to use as few-shot exemplars in the prompts.
|
||
Similar to Figure 1(d), each trajectory consists of multiple thought-action-observation steps (i.e. dense
|
||
thought), where free-form thoughts are used for various purposes. Specifically, we use a combination
|
||
of thoughts that decompose questions (“I need to search x, find y, then find z”), extract information
|
||
from Wikipedia observations (“x was started in 1844”, “The paragraph does not tell x”), perform
|
||
commonsense (“x is not y, so z must instead be...”) or arithmetic reasoning (“1844 < 1989”), guide
|
||
2We find more examples do not improve performance.
|
||
|
||
--- Page 5 ---
|
||
Prompt Methoda
|
||
HotpotQA
|
||
Fever
|
||
(EM)
|
||
(Acc)
|
||
Standard
|
||
28.7
|
||
57.1
|
||
CoT (Wei et al., 2022)
|
||
29.4
|
||
56.3
|
||
CoT-SC (Wang et al., 2022a)
|
||
33.4
|
||
60.4
|
||
Act
|
||
25.7
|
||
58.9
|
||
ReAct
|
||
27.4
|
||
60.9
|
||
CoT-SC →ReAct
|
||
34.2
|
||
64.6
|
||
ReAct→CoT-SC
|
||
35.1
|
||
62.0
|
||
Supervised SoTAb
|
||
67.5
|
||
89.5
|
||
Table 1: PaLM-540B prompting results on
|
||
HotpotQA and Fever.
|
||
aHotpotQA EM is 27.1, 28.9, 33.8 for Standard, CoT,
|
||
CoT-SC in Wang et al. (2022b).
|
||
b(Zhu et al., 2021; Lewis et al., 2020)
|
||
0
|
||
20
|
||
#CoT-SC trials
|
||
26
|
||
28
|
||
30
|
||
32
|
||
34
|
||
HotpotQA EM
|
||
0
|
||
20
|
||
#CoT-SC trials
|
||
47.5
|
||
50.0
|
||
52.5
|
||
55.0
|
||
57.5
|
||
60.0
|
||
62.5
|
||
65.0
|
||
Fever Acc
|
||
Method
|
||
CoT-SC -> ReAct
|
||
ReAct -> CoT-SC
|
||
CoT-SC
|
||
ReAct
|
||
CoT
|
||
Figure 2: PaLM-540B prompting results with respect to
|
||
number of CoT-SC samples used.
|
||
search reformulation (“maybe I can search/look up x instead”), and synthesize the final answer (“...so
|
||
the answer is x”). See Appendix C for more details.
|
||
Baselines
|
||
We systematically ablate ReAct trajectories to build prompts for multiple baselines (with
|
||
formats as Figure 1(1a-1c)): (a) Standard prompting (Standard), which removes all thoughts,
|
||
actions, observations in ReAct trajectories. (b) Chain-of-thought prompting (CoT) (Wei et al.,
|
||
2022), which removes actions and observations and serve as a reasoning-only baseline. We also
|
||
build a self-consistency baseline (CoT-SC) (Wang et al., 2022a;b) by sampling 21 CoT trajectories
|
||
with decoding temperature 0.7 during inference and adopting the majority answer, which is found to
|
||
consistently boost performance over CoT. (c) Acting-only prompt (Act), which removes thoughts
|
||
in ReAct trajectories, loosely resembling how WebGPT (Nakano et al., 2021) interacts with the
|
||
Internet to answer questions, though it operates on a different task and action space, and uses imitation
|
||
and reinforcement learning instead of prompting.
|
||
Combining Internal and External Knowledge
|
||
As will be detail in Section 3.3, we observe that
|
||
the problem solving process demonstrated by ReAct is more factual and grounded, whereas CoT
|
||
is more accurate in formulating reasoning structure but can easily suffer from hallucinated facts
|
||
or thoughts. We therefore propose to incorporate ReAct and CoT-SC, and let the model decide
|
||
when to switch to the other method based on the following heuristics: A) ReAct →CoT-SC: when
|
||
ReAct fails to return an answer within given steps, back off to CoT-SC. We set 7 and 5 steps for
|
||
HotpotQA and FEVER respectively as we find more steps will not improve ReAct performance3.
|
||
B) CoT-SC →ReAct: when the majority answer among n CoT-SC samples occurs less than n/2
|
||
times (i.e. internal knowledge might not support the task confidently), back off to ReAct.
|
||
Finetuning
|
||
Due to the challenge of manually annotating reasoning traces and actions at scale,
|
||
we consider a bootstraping approach similar to Zelikman et al. (2022), using 3,000 trajectories
|
||
with correct answers generated by ReAct (also for other baselines) to finetune smaller language
|
||
models (PaLM-8/62B) to decode trajectories (all thoughts, actions, observations) conditioned on
|
||
input questions/claims. More details are in Appendix B.1.
|
||
3.3
|
||
RESULTS AND OBSERVATIONS
|
||
ReAct outperforms Act consistently
|
||
Table 1 shows HotpotQA and Fever results using PaLM-
|
||
540B as the base model with different prompting methods. We note that ReAct is better than Act
|
||
on both tasks, demonstrating the value of reasoning to guide acting, especially for synthesizing the
|
||
final answer, as shown in Figure 1 (1c-d). Fine-tuning results 3 also confirm the benefit of reasoning
|
||
traces for more informed acting.
|
||
3Of all trajectories with correct final answers, those with 7 steps on HotpotQA and 5 steps on FEVER only
|
||
take up 0.84% and 1.33% respectively.
|
||
|
||
--- Page 6 ---
|
||
Type
|
||
Definition
|
||
ReAct
|
||
CoT
|
||
Success
|
||
True positive
|
||
Correct reasoning trace and facts
|
||
94%
|
||
86%
|
||
False positive
|
||
Hallucinated reasoning trace or facts
|
||
6%
|
||
14%
|
||
Failure
|
||
Reasoning error
|
||
Wrong reasoning trace (including failing to recover from repetitive steps)
|
||
47%
|
||
16%
|
||
Search result error
|
||
Search return empty or does not contain useful information
|
||
23%
|
||
-
|
||
Hallucination
|
||
Hallucinated reasoning trace or facts
|
||
0%
|
||
56%
|
||
Label ambiguity
|
||
Right prediction but did not match the label precisely
|
||
29%
|
||
28%
|
||
Table 2: Types of success and failure modes of ReAct and CoT on HotpotQA, as well as their
|
||
percentages in randomly selected examples studied by human.
|
||
ReAct vs. CoT
|
||
On the other hand, ReAct outperforms CoT on Fever (60.9 vs. 56.3) and slightly
|
||
lags behind CoT on HotpotQA (27.4 vs. 29.4). Fever claims for SUPPORTS/REFUTES might only
|
||
differ by a slight amount (see Appendix D.1), so acting to retrieve accurate and up-to-date knowledge
|
||
is vital. To better understand the behavioral difference between ReAct and CoT on HotpotQA, we
|
||
randomly sampled 50 trajectories with correct and incorrect answers (judged by EM) from ReAct
|
||
and CoT respectively (thus 200 examples in total), and manually labeled their success and failure
|
||
modes in Table 2. Some key observations are as follows:
|
||
A) Hallucination is a serious problem for CoT, resulting in much higher false positive rate than
|
||
ReAct (14% vs. 6%) in success mode, and make up its major failure mode (56%). In contrast, the
|
||
problem solving trajectory of ReActis more grounded, fact-driven, and trustworthy, thanks to the
|
||
access of an external knowledge base.
|
||
B) While interleaving reasoning, action and observation steps improves ReAct’s grounded-
|
||
ness and trustworthiness, such a structural constraint also reduces its flexibility in formulating
|
||
reasoning steps, leading to more reasoning error rate than CoT. we note that there is one frequent
|
||
error pattern specific to ReAct, in which the model repetitively generates the previous thoughts and
|
||
actions, and we categorize it as part of “reasoning error” as the model fails to reason about what the
|
||
proper next action to take and jump out of the loop4.
|
||
C) For ReAct, successfully retrieving informative knowledge via search is critical. Non-
|
||
informative search, which counts for 23% of the error cases, derails the model reasoning and gives
|
||
it a hard time to recover and reformulate thoughts. This is perhaps an expected trade-off between
|
||
factuality and flexibility, which motivates our proposed strategies of combining two methods.
|
||
We provide examples for each success and failure modes in Appendix E.1. We also find some
|
||
HotpotQA questions may contain outdated answer labels, see Figure 4 for example.
|
||
ReAct + CoT-SC perform best for prompting LLMs
|
||
Also shown in Table 1, the best prompting
|
||
method on HotpotQA and Fever are ReAct →CoT-SC and CoT-SC →ReAct respectively.
|
||
Furthermore, Figure 2 shows how different methods perform with respect to the number of CoT-SC
|
||
samples used. While two ReAct + CoT-SC methods are advantageous at one task each, they both
|
||
significantly and consistently outperform CoT-SC across different number of samples, reaching
|
||
CoT-SC performance with 21 samples using merely 3-5 samples. These results indicate the value of
|
||
properly combining model internal knowledge and external knowledge for reasoning tasks.
|
||
ReAct performs best for fine-tuning
|
||
Figure 3 shows the scaling effect of prompting/finetuning
|
||
four methods (Standard, CoT, Act, ReAct) on HotpotQA. With PaLM-8/62B, prompting ReAct
|
||
performs worst among four methods due to the difficulty to learn both reasoning and acting from
|
||
in-context examples. However, when finetuned with just 3,000 examples, ReAct becomes the best
|
||
method among the four, with PaLM-8B finetuned ReAct outperforming all PaLM-62B prompting
|
||
methods, and PaLM-62B finetuned ReAct outperforming all 540B prompting methods. In contrast,
|
||
finetuning Standard or CoT is significantly worse than finetuning ReAct or Act for both PaLM-
|
||
8/62B, as the former essentially teaches models to memorize (potentially halluincated) knowledge
|
||
facts, and the latter teaches models how to (reason and) act to access information from Wikipedia, a
|
||
more generalizable skill for knowledge reasoning. As all prompting methods are still significantly
|
||
far from domain-specific state-of-the-art approaches (Table 1), we believe finetuning with more
|
||
human-written data might be a better way to unleash the power of ReAct.
|
||
4We suspect that this could be due to the sub-optimal greedy decoding procedure, and future work using
|
||
better decoding (e.g. beam search) might help address this issue.
|
||
|
||
--- Page 7 ---
|
||
8b
|
||
62b
|
||
540b
|
||
size
|
||
0
|
||
20
|
||
25
|
||
30
|
||
HotpotQA EM
|
||
learning = prompt
|
||
8b
|
||
62b
|
||
540b
|
||
size
|
||
learning = finetune
|
||
Method
|
||
Standard
|
||
CoT
|
||
Act
|
||
ReAct
|
||
Figure 3: Scaling results for prompting and finetuning on HotPotQA with ReAct (ours) and baselines.
|
||
DECISION MAKING TASKS
|
||
We also test ReAct on two language-based interactive decision-making tasks, ALFWorld and
|
||
WebShop, both of which feature complex environments that require agents to act over long horizons
|
||
with sparse rewards, warranting the need for reasoning to act and explore effectively.
|
||
ALFWorld
|
||
ALFWorld (Shridhar et al., 2020b) (Figure 1(2)) is a synthetic text-based game designed
|
||
to align with the embodied ALFRED benchmark (Shridhar et al., 2020a). It includes 6 types of
|
||
tasks in which an agent needs to achieve a high-level goal (e.g. examine paper under desklamp) by
|
||
navigating and interacting with a simulated household via text actions (e.g. go to coffeetable 1, take
|
||
paper 2, use desklamp 1). A task instance can have more than 50 locations and take an expert policy
|
||
more than 50 steps to solve, thus challenging an agent to plan and track subgoals, as well as explore
|
||
systematically (e.g. check all desks one by one for desklamp). In particular, one challenge built into
|
||
ALFWorld is the need to determine likely locations for common household items (e.g. desklamps will
|
||
likely be on desks, shelfs, or dressers), making this environment a good fit for LLMs to exploit their
|
||
pretrained commonsense knowledge. To prompt ReAct, we randomly annotate three trajectories
|
||
from the training set for each task type, where each trajectory includes sparse thoughts that (1)
|
||
decompose the goal, (2) track subgoal completion, (3) determine the next subgoal, and (4) reason via
|
||
commonsense where to find an object and what to do with it. We show prompts used for ALFWorld
|
||
in Appendix C.4. Following Shridhar et al. (2020b), we evaluate on 134 unseen evaluation games
|
||
in a task-specific setup. For robustness, we construct 6 prompts for each task type through each
|
||
permutation of 2 annotated trajectories from the 3 we annotate. Act prompts are constructed using
|
||
the same trajectories, but without thoughts — since task instances are randomly chosen from the
|
||
training set, it favors neither ReAct nor Act and provides a fair and controlled comparison to test the
|
||
importance of sparse thoughts. For baselines, we use BUTLER (Shridhar et al., 2020b), an imitation
|
||
learning agent trained on 105 expert trajectories for each task type5.
|
||
WebShop
|
||
Can ReAct also interact with noisy real-world language environments for practical
|
||
applications? We investigate WebShop (Yao et al., 2022), a recently proposed online shopping
|
||
website environment with 1.18M real-world products and 12k human instructions. Unlike ALFWorld,
|
||
Webshop contains a high variety of structured and unstructured texts (e.g. product titles, descriptions,
|
||
and options crawled from Amazon), and requires an agent to purchase a product based on a user
|
||
instruction (e.g. “I am looking for a nightstand with drawers. It should have a nickel finish, and
|
||
priced lower than $140”) through web interactions (e.g. search “nightstand drawers”, choose buttons
|
||
such as “color: modern-nickel-white” or “back to search”). This task is evaluated by average score
|
||
(percentage of desired attributes covered by the chosen product averaged across all episodes) and
|
||
success rate (percentage of episodes where the chosen product satisfies all requirements) on 500 test
|
||
instructions. We formulate Act prompts with actions to search, choose product, choose options,
|
||
and buy, with ReAct prompts additionally reasoning to determine what to explore, when to buy,
|
||
and what products options are relevant to the instruction. See Table 6 for an example prompt, and
|
||
Table 10 for model predictions in the Appendix. We compare to an imitation learning (IL) method
|
||
5Micheli & Fleuret (2021) finetuned a GPT-2 model on 3553 task instances and achieved a much improved
|
||
performance than BUTLER, but it is trained on all task types, thus not included as a baseline.
|
||
|
||
--- Page 8 ---
|
||
Method
|
||
Pick
|
||
Clean
|
||
Heat
|
||
Cool
|
||
Look
|
||
Pick 2
|
||
All
|
||
Act (best of 6)
|
||
88
|
||
42
|
||
74
|
||
67
|
||
72
|
||
41
|
||
45
|
||
ReAct (avg)
|
||
65
|
||
39
|
||
83
|
||
76
|
||
55
|
||
24
|
||
57
|
||
ReAct (best of 6)
|
||
92
|
||
58
|
||
96
|
||
86
|
||
78
|
||
41
|
||
71
|
||
ReAct-IM (avg)
|
||
55
|
||
59
|
||
60
|
||
55
|
||
23
|
||
24
|
||
48
|
||
ReAct-IM (best of 6)
|
||
62
|
||
68
|
||
87
|
||
57
|
||
39
|
||
33
|
||
53
|
||
BUTLERg (best of 8)
|
||
33
|
||
26
|
||
70
|
||
76
|
||
17
|
||
22
|
||
BUTLER (best of 8)
|
||
46
|
||
39
|
||
74
|
||
100
|
||
22
|
||
24
|
||
37
|
||
Table 3: AlfWorld task-specific success rates (%). BUTLER and
|
||
BUTLERg results are from Table 4 of Shridhar et al. (2020b). All
|
||
methods use greedy decoding, except that BUTLER uses beam search.
|
||
Method
|
||
Score
|
||
SR
|
||
Act
|
||
62.3
|
||
30.1
|
||
ReAct
|
||
66.6
|
||
40.0
|
||
IL
|
||
59.9
|
||
29.1
|
||
IL+RL
|
||
62.4
|
||
28.7
|
||
Human
|
||
82.1
|
||
59.6
|
||
Expert
|
||
Table 4: Score and suc-
|
||
cess rate (SR) on Web-
|
||
shop. IL/IL+RL taken
|
||
from Yao et al. (2022).
|
||
trained with 1,012 human annotated trajectories, and a imitation + reinforcement learning (IL + RL)
|
||
method additionally trained with 10,587 training instructions.
|
||
Results
|
||
ReAct outperforms Act on both ALFWorld (Table 3) and Webshop (Table 4). On
|
||
ALFWorld, the best ReAct trial achieves an average success rate of 71%, significantly outperforming
|
||
the best Act (45%) and BUTLER (37%) trials. In fact, even the worse ReAct trial (48%) beats
|
||
the best trial of both methods. Moreover, the advantage of ReAct over Act is consistent across
|
||
six controlled trials, with relative performance gain ranging from 33% to 90% and averaging 62%.
|
||
Qualitatively, we saw that, without any thoughts at all, Act fails to correctly decompose goals
|
||
into smaller subgoals, or loses track of the current state of the environment. Example trajectories
|
||
comparing ReAct and Act can be found in Appendix D.2.1 and Appendix D.2.2.
|
||
On Webshop, one-shot Act prompting already performs on par with IL and IL+RL methods. With
|
||
additional sparse reasoning, ReAct achieves significantly better performance, with an absolute 10%
|
||
improvement over the previous best success rate. By checking examples, we find that ReAct is more
|
||
likely to identify instruction-relevant products and options by reasoning to bridge the gap between
|
||
noisy observations and actions (e.g. “For ‘space-saving ottoman bench for living room’, the item
|
||
has options ‘39x18x18inch’ and ‘blue’ and seems good to buy.”). However, existing methods are
|
||
still far from the performance of expert humans (Table 4), who perform significantly more product
|
||
explorations and query re-formulations that are still challenging for prompting-based methods.
|
||
On the value of internal reasoning vs. external feedback
|
||
To our knowledge, ReAct is the first
|
||
demonstration of combined reasoning and action using an LLM applied to an interactive environment
|
||
within a closed-loop system. Perhaps the closest prior work is Inner Monologue (IM), from Huang
|
||
et al. (2022b), in which actions from an embodied agent are motivated by an eponymous “inner
|
||
monologue”. However, IM’s “inner monologue” is limited to observations of the environment
|
||
state and what needs to be completed by the agent for the goal to be satisfied. In contrast, the
|
||
reasoning traces in ReAct for decision making is flexible and sparse, allowing diverse reasoning
|
||
types (see Section 2) to be induced for different tasks.
|
||
To demonstrate the differences between ReAct and IM, and to highlight the importance of internal
|
||
reasoning vs. simple reactions to external feedback, we ran an ablation experiment using a thought
|
||
pattern composed of IM-like dense external feedback. As can be seen in Table 3, ReAct substantially
|
||
outperforms IM-style prompting (ReAct-IM) (71 vs. 53 overall success rate), with consistent
|
||
advantages on five out of six tasks. Qualitatively, we observed that ReAct-IM often made mistakes
|
||
in identifying when subgoals were finished, or what the next subgoal should be, due to a lack of high-
|
||
level goal decomposition. Additionally, many ReAct-IM trajectories struggled to determine where
|
||
an item would likely be within the ALFWorld environment, due to a lack of commonsense reasoning.
|
||
Both shortcomings can be addressed in the ReAct paradigm. More details about ReAct-IM is in
|
||
Appendix B.2. An example prompt for ReAct-IM can be found in Appendix C.4, and an example
|
||
trajectory in Appendix D.2.3.
|
||
|
||
--- Page 9 ---
|
||
|
||
================================================================================
|
||
4 RELATED WORK
|
||
================================================================================
|
||
Language model for reasoning
|
||
Perhaps the most well-known work of using LLMs for reasoning
|
||
is Chain-of-Thought (CoT) (Wei et al., 2022), which reveals the ability of LLMs to formulate their
|
||
own “thinking procedure” for problem solving. Several follow-up works have since been performed,
|
||
including least-to-most prompting for solving complicated tasks (Zhou et al., 2022), zero-shot-
|
||
CoT (Kojima et al., 2022), and reasoning with self-consistency (Wang et al., 2022a). Recently,
|
||
(Madaan & Yazdanbakhsh, 2022) systematically studied the formulation and structure of CoT, and
|
||
observed that the presence of symbols, patterns and texts is crucial to the effectiveness of CoT. Other
|
||
work has also been extended to more sophisticated reasoning architecture beyond simple prompting.
|
||
For example Selection-Inference (Creswell et al., 2022) divides the reasoning process into two steps
|
||
of “selection” and “inference”. STaR (Zelikman et al., 2022) bootstraps the reasoning process by
|
||
finetuning the model on correct rationales generated by the model itself. Faithful reasoning (Creswell
|
||
& Shanahan, 2022) decomposes multi-step reasoning into three steps, each performed by a dedicated
|
||
LM respectively. Similar approaches like Scratchpad (Nye et al., 2021), which finetunes a LM on
|
||
intermediate computation steps, also demonstrate improvement on multi-step computation problems.
|
||
In contrast to these methods, ReAct performs more than just isolated, fixed reasoning, and integrates
|
||
model actions and their corresponding observations into a coherent stream of inputs for the model to
|
||
reason more accurately and tackle tasks beyond reasoning (e.g. interactive decision making).
|
||
Language model for decision making
|
||
The strong capability of LLMs has enabled them to perform
|
||
tasks beyond language generation, and it is becoming more popular to take advantage of LLMs as a
|
||
policy model for decision making, especially in interactive environments. WebGPT (Nakano et al.,
|
||
2021) uses an LM to interact with web browsers, navigate through web pages, and infer answers to
|
||
complicated questions from ELI5 (Fan et al., 2019). In comparison to ReAct, WebGPT does not
|
||
explicitly model the thinking and reasoning procedure, instead rely on expensive human feedback for
|
||
reinforcement learning. In conversation modeling, chatbots like BlenderBot (Shuster et al., 2022b)
|
||
and Sparrow (Glaese et al., 2022) and task-oriented dialogue systems like SimpleTOD (Hosseini-Asl
|
||
et al., 2020) also train LMs to make decision about API calls. Unlike ReAct, they do not explicitly
|
||
consider the reasoning procedure either, and also relies on expensive datasets and human feedback
|
||
collections for policy learning. In contrast, ReAct learns a policy in a much cheaper way, since the
|
||
decision making process only requires language description of the reasoning procedure.6
|
||
LLMS have also been increasingly employed in interactive and embodied environments for planning
|
||
and decision making. Perhaps most relevant to ReAct in this respect are SayCan (Ahn et al., 2022)
|
||
and Inner Monologue (Huang et al., 2022b), which use LLMs for robotic action planning and decision
|
||
making. In SayCan, LLMs were prompted to directly predict possible actions a robot can take, which
|
||
is then reranked by an affordance model grounded on the visual environments for final prediction.
|
||
Inner Monologue made further improvements by adding the eponymous “inner monologue", which is
|
||
implemented as injected feedback from the environment. To our knowledge, Inner Monologue is the
|
||
first work that demonstrates such a closed-loop system, which ReAct builds on. However, we argue
|
||
that Inner Monologue does not truly comprise of inner thoughts — this is elaborated in Section 4. We
|
||
also note that leveraging language as semantically-rich inputs in the process of interactive decision
|
||
making has been shown to be successful under other settings (Abramson et al., 2020; Karamcheti
|
||
et al., 2021; Huang et al., 2022a; Li et al., 2022). It is becoming more evident that with the help of
|
||
LLMs, language as a fundamental cognitive mechanism will play a critical role in interaction and
|
||
decision making. What is more, progress in LLMs has also inspired the development of versatile and
|
||
generalist agents like Reed et al. (2022).
|
||
|
||
================================================================================
|
||
5 CONCLUSIONS
|
||
================================================================================
|
||
We have proposed ReAct – a simple yet effective method for synergizing reasoning and acting in
|
||
large language models. Through a diverse set of experiments on multi-hop question-answering, fact
|
||
checking, and interactive decision-making tasks, we show that ReAct leads to superior performance
|
||
with interpretable decision traces. Despite the simplicity of our method, complex tasks with large
|
||
action spaces require more demonstrations to learn well, which unfortunately can easily go beyond
|
||
the input length limit of in-context learning. We explore the fine-tuning approach on HotpotQA
|
||
6Human feedback can also be incorporated in a complementary manner but we leave it for future work.
|
||
|
||
--- Page 10 ---
|
||
with initial promising results, but learning from more high-quality human annotations will be the
|
||
desiderata to further improve the performance. Scaling up ReAct with multi-task training and
|
||
combining it with complementary paradigms like reinforcement learning could result in stronger
|
||
agents that further unlock the potential of LLMs for more applications.
|
||
ACKNOWLEDGMENTS
|
||
We thank the support and feedback of many people from Google Brain team and Princeton NLP
|
||
Group. This work was supported in part by the National Science Foundation under Grant No.
|
||
2107048. Any opinions, findings, and conclusions or recommendations expressed in this material are
|
||
those of the author(s) and do not necessarily reflect the views of the National Science Foundation.
|
||
REPRODUCIBILITY STATEMENT
|
||
Our main experiments are done on PaLM (Chowdhery et al., 2022), which is not an openly accessible
|
||
model yet. To increase reproducibility, we have included all used prompts in Appendix C, additional
|
||
experiments using GPT-3 (Brown et al., 2020) in Appendix A.1, and associated GPT-3 ReAct
|
||
prompting code at https://anonymous.4open.science/r/ReAct-2268/.
|
||
ETHICS STATEMENT
|
||
ReAct prompts large language models to generate more human interpretable, diagnosable, and
|
||
controllable task-solving trajectories than previous methods. However, hooking up a large language
|
||
model with an action space to interact with external environments (e.g. the web, physical environ-
|
||
ments) has potential dangers, e.g. looking up inappropriate or private information, or taking harmful
|
||
actions in an environment. Our experiments minimize such risks by limiting the interactions to
|
||
specific websites (Wikipedia or WebShop) that are free of private information, without any dangerous
|
||
actions in the action space design (i.e. models cannot really buy products on WebShop the research
|
||
benchmark, or edit Wikipedia). We believe researchers should be aware of such risks before designing
|
||
more extensive experiments in the future.
|