This commit consolidates a large set of host-mode security and UX fixes across backend and frontend. Security / execution model: - Make permission/execution mode switches apply immediately (no deferred pending-only behavior). - Keep runtime mode change notices durable and visible via user-message guidance path. - Add explicit runtime message source taxonomy support and persistence: user / presend / guidance / notify / sub_agent / background_command. - Ensure guidance/notify insertion is batched per tool-cycle so mid-run inserts are committed together. - Separate notify from guidance semantics for mode-change notices. - Add direct-mode auto-fallback handling visibility on frontend. Approval and command gating: - Align run_command approval pre-check logic with docker behavior for approval/auto_approval modes in host execution paths. - Keep approval retry flow and final-result semantics intact when permission errors trigger approval. - Externalize forbidden command keyword list into JSON config: config/forbidden_commands.json. - Update forbidden command rejection message to user-facing wording: 用户不允许执行包含“... ”的指令. Prompt/runtime guidance: - Refine execution-mode runtime rule text to avoid endless workaround loops: one safe alternative first, then request switching to direct mode when truly required. Chat rendering / message UX: - Prevent injected guidance/notify user-messages from incorrectly triggering assistant work header/timer chain. - Restore correct visibility after history reload while preserving runtime-source behavior. - Update user-header icon/label rendering by message source: - guidance -> 引导 + navigation icon - notify/sub_agent/background_command -> 通知 + bell icon - user/presend -> keep normal user header. - Add new icons: static/icons/navigation.svg, static/icons/bell.svg. Approval panel UX: - Convert desktop approval panel from layout-compress sidebar to overlay + blur sheet. - Fix panel transition behavior (remove unintended vertical motion; use dedicated desktop overlay transition). - Improve approval result display: - decision and reason split lines, - green/red status styling, - multiline reason rendering, - auto-collapse delay adjusted to 3s. Execution mode TTL feedback: - When direct mode auto-expires to sandbox, frontend menu state is updated from status snapshot. - Show non-auto-dismiss warning toast to explicitly notify auto-fallback. Misc consistency updates: - Execution mode label text cleanup in composer. - Runtime notice wording normalization (权限模式修改为..., 执行环境修改为...). Build/test notes: - Frontend rebuilt after UI changes. - Smoke tests passed for server refactor path.
2830 lines
109 KiB
Plaintext
2830 lines
109 KiB
Plaintext
|
||
--- Page 1 ---
|
||
Published as a conference paper at ICLR 2023
|
||
REACT: SYNERGIZING REASONING AND ACTING IN
|
||
LANGUAGE MODELS
|
||
Shunyu Yao∗*,1, Jeffrey Zhao2, Dian Yu2, Nan Du2, Izhak Shafran2, Karthik Narasimhan1, Yuan Cao2
|
||
1Department of Computer Science, Princeton University
|
||
2Google Research, Brain team
|
||
1{shunyuy,karthikn}@princeton.edu
|
||
2{jeffreyzhao,dianyu,dunan,izhak,yuancao}@google.com
|
||
ABSTRACT
|
||
While large language models (LLMs) have demonstrated impressive performance
|
||
across tasks in language understanding and interactive decision making, their
|
||
abilities for reasoning (e.g. chain-of-thought prompting) and acting (e.g. action
|
||
plan generation) have primarily been studied as separate topics. In this paper, we
|
||
explore the use of LLMs to generate both reasoning traces and task-specific actions
|
||
in an interleaved manner, allowing for greater synergy between the two: reasoning
|
||
traces help the model induce, track, and update action plans as well as handle
|
||
exceptions, while actions allow it to interface with and gather additional information
|
||
from external sources such as knowledge bases or environments. We apply our
|
||
approach, named ReAct, to a diverse set of language and decision making tasks
|
||
and demonstrate its effectiveness over state-of-the-art baselines in addition to
|
||
improved human interpretability and trustworthiness. Concretely, on question
|
||
answering (HotpotQA) and fact verification (Fever), ReAct overcomes prevalent
|
||
issues of hallucination and error propagation in chain-of-thought reasoning by
|
||
interacting with a simple Wikipedia API, and generating human-like task-solving
|
||
trajectories that are more interpretable than baselines without reasoning traces.
|
||
Furthermore, on two interactive decision making benchmarks (ALFWorld and
|
||
WebShop), ReAct outperforms imitation and reinforcement learning methods by
|
||
an absolute success rate of 34% and 10% respectively, while being prompted with
|
||
only one or two in-context examples.
|
||
1
|
||
INTRODUCTION
|
||
A unique feature of human intelligence is the ability to seamlessly combine task-oriented actions with
|
||
verbal reasoning (or inner speech, Alderson-Day & Fernyhough, 2015), which has been theorized to
|
||
play an important role in human cognition for enabling self-regulation or strategization (Vygotsky,
|
||
1987; Luria, 1965; Fernyhough, 2010) and maintaining a working memory (Baddeley, 1992). Con-
|
||
sider the example of cooking up a dish in the kitchen. Between any two specific actions, we may
|
||
reason in language in order to track progress (“now that everything is cut, I should heat up the pot of
|
||
water”), to handle exceptions or adjust the plan according to the situation (“I don’t have salt, so let
|
||
me use soy sauce and pepper instead”), and to realize when external information is needed (“how do
|
||
I prepare dough? Let me search on the Internet”). We may also act (open a cookbook to read the
|
||
recipe, open the fridge, check ingredients) to support the reasoning and to answer questions (“What
|
||
dish can I make right now?”). This tight synergy between “acting” and “reasoning” allows humans
|
||
to learn new tasks quickly and perform robust decision making or reasoning, even under previously
|
||
unseen circumstances or facing information uncertainties.
|
||
Recent results have hinted at the possibility of combining verbal reasoning with interactive decision
|
||
making in autonomous systems. On one hand, properly prompted large language models (LLMs)
|
||
have demonstrated emergent capabilities to carry out several steps of reasoning traces to derive
|
||
∗Work during Google internship. Projet page with code: https://react-lm.github.io/.
|
||
1
|
||
arXiv:2210.03629v3 [cs.CL] 10 Mar 2023
|
||
|
||
--- Page 2 ---
|
||
Published as a conference paper at ICLR 2023
|
||
$FW7KLQN>)LUVW,QHHGWRILQGDSHSSHUVKDNHUPRUH
|
||
OLNHO\WRDSSHDULQFDELQHWVFRXQWHUWRSV
|
||
@
|
||
$FW*RWRFDELQHW
|
||
2EV2QWKHFDELQHW\RXVHHDYDVH
|
||
+HUHWKHDJHQWJRWRFDELQHWWKHQFDELQHWWKHQFRXQWHUWRSDQG
|
||
$FW*RWRFRXQWHUWRS
|
||
2EV2QWKHFRXQWHUWRS\RXVHHDDSSOHDEUHDG
|
||
|
||
DSHSSHUVKDNHUDQGDYDVH
|
||
$FW7DNHSHSSHUVKDNHUIURPFRXQWHUWRS
|
||
2EV<RXSLFNXSWKHSHSSHUVKDNHUIURPWKHFRXQWHUWRS
|
||
|
||
$FW7KLQN>1RZ,ILQGDSHSSHUVKDNHU1H[W,QHHGWR
|
||
|
||
SXWLWLQRQGUDZHU @
|
||
$FW*RWRGUDZHU
|
||
2EV'UDZHULVFORVHG
|
||
$FW2SHQGUDZHU
|
||
2EV<RXRSHQ'UDZHUª
|
||
$FW3XWSHSSHUVKDNHULQRQGUDZHU
|
||
2EV<RXSXWSHSSHUVKDNHULQRQWKHGUDZHU
|
||
D6WDQGDUG
|
||
$QVZHUL3RG
|
||
E&R75HDVRQ2QO\
|
||
7KRXJKW/HW
|
||
VWKLQNVWHS
|
||
E\VWHS $SSOH5HPRWHZDV
|
||
RULJLQDOO\GHVLJQHGWR
|
||
LQWHUDFWZLWK$SSOH79
|
||
$SSOH79FDQEHFRQWUROOHG
|
||
E\L3KRQHL3DGDQGL3RG
|
||
7RXFK6RWKHDQVZHULV
|
||
L3KRQHL3DGDQGL3RG
|
||
7RXFK
|
||
$QVZHUL3KRQHL3DGL3RG
|
||
7RXFK
|
||
F$FW2QO\
|
||
$FW6HDUFK>$SSOH5HPRWH@
|
||
2EV7KH$SSOH5HPRWHLV D
|
||
UHPRWHFRQWUROª
|
||
$FW6HDUFK>)URQW5RZ @
|
||
2EV&RXOGQRWILQG>)URQW
|
||
5RZ@6LPLODUª
|
||
$FW6HDUFK>)URQW5RZ
|
||
VRIWZDUH @
|
||
2EV)URQW5RZLVD
|
||
GLVFRQWLQXHGPHGLDFHQWHU
|
||
VRIWZDUHª
|
||
$FW)LQLVK>\HV@
|
||
G5H$FW5HDVRQ$FW
|
||
7KRXJKW,QHHGWRVHDUFK$SSOH5HPRWHDQGILQGWKH
|
||
SURJUDPLWZDVRULJLQDOO\GHVLJQHGWRLQWHUDFWZLWK
|
||
$FW6HDUFK>$SSOH5HPRWH@
|
||
2EV7KH$SSOH5HPRWHLVDUHPRWHFRQWUROLQWURGXFHGLQ
|
||
|
||
2FWREHUE\$SSOHªRULJLQDOO\GHVLJQHGWRFRQWUROWKH
|
||
|
||
)URQW5RZPHGLDFHQWHU SURJUDPª
|
||
7KRXJKW$SSOH5HPRWHZDVRULJLQDOO\GHVLJQHGWRFRQWURO
|
||
|
||
WKH)URQW5RZPHGLDFHQWHUSURJUDP,QHHGWRVHDUFK
|
||
)URQW
|
||
5RZQH[WDQGILQGZKDWRWKHUGHYLFHFDQFRQWUROLW
|
||
$FW6HDUFK>)URQW5RZ@
|
||
2EV&RXOGQRWILQG>)URQW5RZ@6LPLODU>
|
||
)URQW5RZ
|
||
|
||
6HDWWR(DUWK
|
||
|
||
)URQW5RZ0RWRUVSRUWV
|
||
|
||
)URQW5RZ
|
||
VRIWZDUH
|
||
ª@
|
||
7KRXJKW)URQW5RZLVQRWIRXQG,QHHGWRVHDUFK )URQW
|
||
5RZVRIWZDUH
|
||
$FW6HDUFK>)URQW5RZVRIWZDUH @
|
||
2EV)URQW5RZLVDGLVFRQWLQXHGPHGLDFHQWHUVRIWZDUHª
|
||
7KRXJKW)URQW5RZVRIWZDUHLVFRQWUROOHGE\DQ$SSOH
|
||
|
||
5HPRWHRUWKHNH\ERDUGIXQFWLRQNH\V 6RWKHDQVZHULV
|
||
NH\ERDUGIXQFWLRQNH\V
|
||
$FW)LQLVK>NH\ERDUGIXQFWLRQNH\V @
|
||
Ҽ
|
||
4XHVWLRQ$VLGHIURPWKH$SSOH5HPRWHZKDWRWKHUGHYLFH
|
||
|
||
FDQFRQWUROWKHSURJUDP$SSOH5HPRWHZDVRULJLQDOO\
|
||
|
||
GHVLJQHGWRLQWHUDFWZLWK"
|
||
D$FW2QO\
|
||
$FW*RWRGUDZHU
|
||
2EV7KHGUDZHULVFORVHG
|
||
$FW2SHQGUDZHU
|
||
2EV<RXRSHQWKHGUDZHU7KHGUDZHULVRSHQ,QLW
|
||
|
||
\RXVHHDGLVKVSRQJHDQGDVSRRQ
|
||
|
||
$FW*RWRVLQNEDVLQ
|
||
2EV2QWKHVLQNEDVLQ\RXVHHDGLVKVSRQJHD
|
||
|
||
VSDWXODDQGDVSRRQ
|
||
$FW7DNHSHSSHUVKDNHUIURPVLQNEDVLQ
|
||
2EV1RWKLQJKDSSHQV
|
||
$FW7DNHSHSSHUVKDNHUIURPVLQNEDVLQ
|
||
2EV1RWKLQJKDSSHQV
|
||
E5H$FW5HDVRQ$FW
|
||
Ҽ
|
||
<RXDUHLQWKHPLGGOHRIDURRP/RRNLQJTXLFNO\DURXQG
|
||
|
||
\RX\RXVHHDFDELQHWDFDELQHWDFRIIHHPDFKLQH
|
||
|
||
DFRXQWHUWRSDVWRYHEXUQHUDQGDWRDVWHU
|
||
|
||
<RXUWDVNLVWR3XWVRPHSHSSHUVKDNHURQDGUDZHU
|
||
$OI:RUOG
|
||
+RWVSRW4$
|
||
Figure 1: (1) Comparison of 4 prompting methods, (a) Standard, (b) Chain-of-thought (CoT,
|
||
Reason Only), (c) Act-only, and (d) ReAct (Reason+Act), solving a HotpotQA (Yang et al., 2018)
|
||
question. (2) Comparison of (a) Act-only and (b) ReAct prompting to solve an AlfWorld (Shridhar
|
||
et al., 2020b) game. In both domains, we omit in-context examples in the prompt, and only show task
|
||
solving trajectories generated by the model (Act, Thought) and the environment (Obs).
|
||
answers from questions in arithmetic, commonsense, and symbolic reasoning tasks (Wei et al.,
|
||
2022). However, this “chain-of-thought” reasoning is a static black box, in that the model uses
|
||
its own internal representations to generate thoughts and is not grounded in the external world,
|
||
which limits its ability to reason reactively or update its knowledge. This can lead to issues like fact
|
||
hallucination and error propagation over the reasoning process (Figure 1 (1b)). On the other hand,
|
||
recent work has explored the use of pre-trained language models for planning and acting in interactive
|
||
environments (Ahn et al., 2022; Nakano et al., 2021; Yao et al., 2020; Huang et al., 2022a), with
|
||
a focus on predicting actions via language priors. These approaches usually convert multi-modal
|
||
observations into text, use a language model to generate domain-specific actions or plans, and then
|
||
use a controller to choose or execute them. However, they do not employ language models to reason
|
||
abstractly about high-level goals or maintain a working memory to support acting, barring Huang
|
||
et al. (2022b) who perform a limited form of verbal reasoning to reiterate spatial facts about the
|
||
current state. Beyond such simple embodied tasks to interact with a few blocks, there have not been
|
||
studies on how reasoning and acting can be combined in a synergistic manner for general task solving,
|
||
and if such a combination can bring systematic benefits compared to reasoning or acting alone.
|
||
In this work, we present ReAct, a general paradigm to combine reasoning and acting with language
|
||
models for solving diverse language reasoning and decision making tasks (Figure 1). ReAct
|
||
prompts LLMs to generate both verbal reasoning traces and actions pertaining to a task in an
|
||
interleaved manner, which allows the model to perform dynamic reasoning to create, maintain, and
|
||
adjust high-level plans for acting (reason to act), while also interact with the external environments
|
||
(e.g. Wikipedia) to incorporate additional information into reasoning (act to reason).
|
||
2
|
||
|
||
--- Page 3 ---
|
||
Published as a conference paper at ICLR 2023
|
||
We conduct empirical evaluations of ReAct and state-of-the-art baselines on four diverse benchmarks:
|
||
question answering (HotPotQA, Yang et al., 2018), fact verification (Fever, Thorne et al., 2018),
|
||
text-based game (ALFWorld, Shridhar et al., 2020b), and webpage navigation (WebShop, Yao
|
||
et al., 2022). For HotPotQA and Fever, with access to a Wikipedia API that the model can interact
|
||
with, ReAct outperforms vanilla action generation models while being competitive with chain-of-
|
||
thought reasoning (CoT) (Wei et al., 2022). The best approach overall is a combination of ReAct
|
||
and CoT that allows for the use of both internal knowledge and externally obtained information
|
||
during reasoning. On ALFWorld and WebShop, two or even one-shot ReAct prompting is able
|
||
to outperform imitation or reinforcement learning methods trained with 103 ∼105 task instances,
|
||
with an absolute improvement of 34% and 10% in success rates respectively. We also demonstrate
|
||
the importance of sparse, versatile reasoning in decision making by showing consistent advantages
|
||
over controlled baselines with actions only. Besides general applicability and performance boost,
|
||
the combination of reasoning and acting also contributes to model interpretability, trustworthiness,
|
||
and diagnosability across all domains, as humans can readily distinguish information from model’s
|
||
internal knowledge versus external environments, as well as inspect reasoning traces to understand
|
||
the decision basis of model actions.
|
||
To summarize, our key contributions are the following: (1) we introduce ReAct, a novel prompt-
|
||
based paradigm to synergize reasoning and acting in language models for general task solving; (2) we
|
||
perform extensive experiments across diverse benchmarks to showcase the advantage of ReAct in a
|
||
few-shot learning setup over prior approaches that perform either reasoning or action generation in
|
||
isolation; (3) we present systematic ablations and analysis to understand the importance of acting in
|
||
reasoning tasks, and reasoning in interactive tasks; (4) we analyze the limitations of ReAct under the
|
||
prompting setup (i.e. limited support of reasoning and acting behaviors), and perform initial finetuning
|
||
experiments showing the potential of ReAct to improve with additional training data. Scaling up
|
||
ReAct to train and operate on more tasks and combining it with complementary paradigms like
|
||
reinforcement learning could further unlock the potential of large language models.
|
||
2
|
||
REAC T: SYNERGIZING REASONING + ACTING
|
||
Consider a general setup of an agent interacting with an environment for task solving. At time
|
||
step t, an agent receives an observation ot ∈O from the environment and takes an action at ∈A
|
||
following some policy π(at|ct), where ct = (o1, a1, · · · , ot−1, at−1, ot) is the context to the agent.
|
||
Learning a policy is challenging when the mapping ct 7→at is highly implicit and requires extensive
|
||
computation. For example, the agent shown in Figure 1(1c) is unable to generate the correct final
|
||
action (Act 4) to finish the QA task as it requires complex reasoning over the trajectory context
|
||
(Question, Act 1-3, Obs 1-3). Similarly, the agent shown in Figure 1(2a) fails to comprehend from the
|
||
context that sinkbasin 1 does not contain peppershaker 1, thus keep producing hallucinating actions.
|
||
The idea of ReAct is simple: we augment the agent’s action space to ˆ
|
||
A = A ∪L, where L is the
|
||
space of language. An action ˆat ∈L in the language space, which we will refer to as a thought or a
|
||
reasoning trace, does not affect the external environment, thus leading to no observation feedback.
|
||
Instead, a thought ˆat aims to compose useful information by reasoning over the current context ct,
|
||
and update the context ct+1 = (ct, ˆat) to support future reasoning or acting. As shown in Figure 1,
|
||
there could be various types of useful thoughts, e.g. decomposing task goals and create action plans
|
||
(2b, Act 1; 1d, Thought 1), injecting commonsense knowledge relevant to task solving (2b, Act 1),
|
||
extracting important parts from observations (1d, Thought2, 4), track progress and transit action plans
|
||
(2b, Act 8), handle exceptions and adjust action plans (1d, Thought 3), and so on.
|
||
However, as the language space L is unlimited, learning in this augmented action space is difficult
|
||
and requires strong language priors. In this paper, we mainly focus on the setup where a frozen
|
||
large language model, PaLM-540B (Chowdhery et al., 2022)1, is prompted with few-shot in-context
|
||
examples to generate both domain-specific actions and free-form language thoughts for task solving
|
||
(Figure 1 (1d), (2b)). Each in-context example is a human trajectory of actions, thoughts, and
|
||
environment observations to solve a task instance (see Appendix C). For the tasks where reasoning is
|
||
of primary importance (Figure 1(1)), we alternate the generation of thoughts and actions so that the
|
||
task-solving trajectory consists of multiple thought-action-observation steps. In contrast, for decision
|
||
making tasks that potentially involve a large number of actions (Figure 1(2)), thoughts only need to
|
||
1We show some GPT-3 (Brown et al., 2020) results in Appendix A.1, which outperforms PaLM-540B.
|
||
3
|
||
|
||
--- Page 4 ---
|
||
Published as a conference paper at ICLR 2023
|
||
appear sparsely in the most relevant positions of a trajectory, so we let the language model decide the
|
||
asynchronous occurrence of thoughts and actions for itself.
|
||
Since decision making and reasoning capabilities are integrated into a large language model, ReAct
|
||
enjoys several unique features: A) Intuitive and easy to design: Designing ReAct prompts is
|
||
straightforward as human annotators just type down their thoughts in language on top of their actions
|
||
taken. No ad-hoc format choice, thought design, or example selection is used in this paper. We detail
|
||
prompt design for each task in Sections 3 and 4. B) General and flexible: Due to the flexible thought
|
||
space and thought-action occurrence format, ReAct works for diverse tasks with distinct action
|
||
spaces and reasoning needs, including but not limited to QA, fact verification, text game, and web
|
||
navigation. C) Performant and robust: ReAct shows strong generalization to new task instances
|
||
while learning solely from one to six in-context examples, consistently outperforming baselines with
|
||
only reasoning or acting across different domains. We also show in Section 3 additional benefits
|
||
when finetuning is enabled, and in Section 4 how ReAct performance is robust to prompt selections.
|
||
D) Human aligned and controllable: ReAct promises an interpretable sequential decision making
|
||
and reasoning process where humans can easily inspect reasoning and factual correctness. Moreover,
|
||
humans can also control or correct the agent behavior on the go by thought editing, as shown in
|
||
Figure 5 in Section 4.
|
||
3
|
||
KNOWLEDGE-INTENSIVE REASONING TASKS
|
||
We begin with knowledge-intensive reasoning tasks like multi-hop question answering and fact
|
||
verification. As shown in Figure 1(1d), by interacting with a Wikipedia API, ReAct is able to
|
||
retrieve information to support reasoning, while also use reasoning to target what to retrieve next,
|
||
demonstrating a synergy of reasoning and acting.
|
||
3.1
|
||
SETUP
|
||
Domains
|
||
We consider two datasets challenging knowledge retrieval and reasoning: (1) Hot-
|
||
PotQA (Yang et al., 2018), a multi-hop question answering benchmark that requires reasoning
|
||
over two or more Wikipedia passages, and (2) FEVER (Thorne et al., 2018), a fact verification
|
||
benchmark where each claim is annotated SUPPORTS, REFUTES, or NOT ENOUGH INFO, based
|
||
on if there exists a Wikipedia passage to verify the claim. In this work, we operate in a question-only
|
||
setup for both tasks, where models only receive the question/claim as input without access to support
|
||
paragraphs, and have to rely on their internal knowledge or retrieve knowledge via interacting with
|
||
an external environment to support reasoning.
|
||
Action Space
|
||
We design a simple Wikipedia web API with three types of actions to support
|
||
interactive information retrieval: (1) search[entity], which returns the first 5 sentences from
|
||
the corresponding entity wiki page if it exists, or else suggests top-5 similar entities from the
|
||
Wikipedia search engine, (2) lookup[string], which would return the next sentence in the page
|
||
containing string, simulating Ctrl+F functionality on the browser. (3) finish[answer], which
|
||
would finish the current task with answer. We note that this action space mostly can only retrieve a
|
||
small part of a passage based on exact passage name, which is significantly weaker than state-of-the-
|
||
art lexical or neural retrievers. The purpose is to simulate how humans would interact with Wikipedia,
|
||
and force models to retrieve via explicit reasoning in language.
|
||
3.2
|
||
METHODS
|
||
ReAct Prompting
|
||
For HotpotQA and Fever, we randomly select 6 and 3 cases2 from the training
|
||
set and manually compose ReAct-format trajectories to use as few-shot exemplars in the prompts.
|
||
Similar to Figure 1(d), each trajectory consists of multiple thought-action-observation steps (i.e. dense
|
||
thought), where free-form thoughts are used for various purposes. Specifically, we use a combination
|
||
of thoughts that decompose questions (“I need to search x, find y, then find z”), extract information
|
||
from Wikipedia observations (“x was started in 1844”, “The paragraph does not tell x”), perform
|
||
commonsense (“x is not y, so z must instead be...”) or arithmetic reasoning (“1844 < 1989”), guide
|
||
2We find more examples do not improve performance.
|
||
4
|
||
|
||
--- Page 5 ---
|
||
Published as a conference paper at ICLR 2023
|
||
Prompt Methoda
|
||
HotpotQA
|
||
Fever
|
||
(EM)
|
||
(Acc)
|
||
Standard
|
||
28.7
|
||
57.1
|
||
CoT (Wei et al., 2022)
|
||
29.4
|
||
56.3
|
||
CoT-SC (Wang et al., 2022a)
|
||
33.4
|
||
60.4
|
||
Act
|
||
25.7
|
||
58.9
|
||
ReAct
|
||
27.4
|
||
60.9
|
||
CoT-SC →ReAct
|
||
34.2
|
||
64.6
|
||
ReAct→CoT-SC
|
||
35.1
|
||
62.0
|
||
Supervised SoTAb
|
||
67.5
|
||
89.5
|
||
Table 1: PaLM-540B prompting results on
|
||
HotpotQA and Fever.
|
||
aHotpotQA EM is 27.1, 28.9, 33.8 for Standard, CoT,
|
||
CoT-SC in Wang et al. (2022b).
|
||
b(Zhu et al., 2021; Lewis et al., 2020)
|
||
0
|
||
5
|
||
10
|
||
15
|
||
20
|
||
#CoT-SC trials
|
||
26
|
||
28
|
||
30
|
||
32
|
||
34
|
||
HotpotQA EM
|
||
0
|
||
5
|
||
10
|
||
15
|
||
20
|
||
#CoT-SC trials
|
||
47.5
|
||
50.0
|
||
52.5
|
||
55.0
|
||
57.5
|
||
60.0
|
||
62.5
|
||
65.0
|
||
Fever Acc
|
||
Method
|
||
CoT-SC -> ReAct
|
||
ReAct -> CoT-SC
|
||
CoT-SC
|
||
ReAct
|
||
CoT
|
||
Figure 2: PaLM-540B prompting results with respect to
|
||
number of CoT-SC samples used.
|
||
search reformulation (“maybe I can search/look up x instead”), and synthesize the final answer (“...so
|
||
the answer is x”). See Appendix C for more details.
|
||
Baselines
|
||
We systematically ablate ReAct trajectories to build prompts for multiple baselines (with
|
||
formats as Figure 1(1a-1c)): (a) Standard prompting (Standard), which removes all thoughts,
|
||
actions, observations in ReAct trajectories. (b) Chain-of-thought prompting (CoT) (Wei et al.,
|
||
2022), which removes actions and observations and serve as a reasoning-only baseline. We also
|
||
build a self-consistency baseline (CoT-SC) (Wang et al., 2022a;b) by sampling 21 CoT trajectories
|
||
with decoding temperature 0.7 during inference and adopting the majority answer, which is found to
|
||
consistently boost performance over CoT. (c) Acting-only prompt (Act), which removes thoughts
|
||
in ReAct trajectories, loosely resembling how WebGPT (Nakano et al., 2021) interacts with the
|
||
Internet to answer questions, though it operates on a different task and action space, and uses imitation
|
||
and reinforcement learning instead of prompting.
|
||
Combining Internal and External Knowledge
|
||
As will be detail in Section 3.3, we observe that
|
||
the problem solving process demonstrated by ReAct is more factual and grounded, whereas CoT
|
||
is more accurate in formulating reasoning structure but can easily suffer from hallucinated facts
|
||
or thoughts. We therefore propose to incorporate ReAct and CoT-SC, and let the model decide
|
||
when to switch to the other method based on the following heuristics: A) ReAct →CoT-SC: when
|
||
ReAct fails to return an answer within given steps, back off to CoT-SC. We set 7 and 5 steps for
|
||
HotpotQA and FEVER respectively as we find more steps will not improve ReAct performance3.
|
||
B) CoT-SC →ReAct: when the majority answer among n CoT-SC samples occurs less than n/2
|
||
times (i.e. internal knowledge might not support the task confidently), back off to ReAct.
|
||
Finetuning
|
||
Due to the challenge of manually annotating reasoning traces and actions at scale,
|
||
we consider a bootstraping approach similar to Zelikman et al. (2022), using 3,000 trajectories
|
||
with correct answers generated by ReAct (also for other baselines) to finetune smaller language
|
||
models (PaLM-8/62B) to decode trajectories (all thoughts, actions, observations) conditioned on
|
||
input questions/claims. More details are in Appendix B.1.
|
||
3.3
|
||
RESULTS AND OBSERVATIONS
|
||
ReAct outperforms Act consistently
|
||
Table 1 shows HotpotQA and Fever results using PaLM-
|
||
540B as the base model with different prompting methods. We note that ReAct is better than Act
|
||
on both tasks, demonstrating the value of reasoning to guide acting, especially for synthesizing the
|
||
final answer, as shown in Figure 1 (1c-d). Fine-tuning results 3 also confirm the benefit of reasoning
|
||
traces for more informed acting.
|
||
3Of all trajectories with correct final answers, those with 7 steps on HotpotQA and 5 steps on FEVER only
|
||
take up 0.84% and 1.33% respectively.
|
||
5
|
||
|
||
--- Page 6 ---
|
||
Published as a conference paper at ICLR 2023
|
||
Type
|
||
Definition
|
||
ReAct
|
||
CoT
|
||
Success
|
||
True positive
|
||
Correct reasoning trace and facts
|
||
94%
|
||
86%
|
||
False positive
|
||
Hallucinated reasoning trace or facts
|
||
6%
|
||
14%
|
||
Failure
|
||
Reasoning error
|
||
Wrong reasoning trace (including failing to recover from repetitive steps)
|
||
47%
|
||
16%
|
||
Search result error
|
||
Search return empty or does not contain useful information
|
||
23%
|
||
-
|
||
Hallucination
|
||
Hallucinated reasoning trace or facts
|
||
0%
|
||
56%
|
||
Label ambiguity
|
||
Right prediction but did not match the label precisely
|
||
29%
|
||
28%
|
||
Table 2: Types of success and failure modes of ReAct and CoT on HotpotQA, as well as their
|
||
percentages in randomly selected examples studied by human.
|
||
ReAct vs. CoT
|
||
On the other hand, ReAct outperforms CoT on Fever (60.9 vs. 56.3) and slightly
|
||
lags behind CoT on HotpotQA (27.4 vs. 29.4). Fever claims for SUPPORTS/REFUTES might only
|
||
differ by a slight amount (see Appendix D.1), so acting to retrieve accurate and up-to-date knowledge
|
||
is vital. To better understand the behavioral difference between ReAct and CoT on HotpotQA, we
|
||
randomly sampled 50 trajectories with correct and incorrect answers (judged by EM) from ReAct
|
||
and CoT respectively (thus 200 examples in total), and manually labeled their success and failure
|
||
modes in Table 2. Some key observations are as follows:
|
||
A) Hallucination is a serious problem for CoT, resulting in much higher false positive rate than
|
||
ReAct (14% vs. 6%) in success mode, and make up its major failure mode (56%). In contrast, the
|
||
problem solving trajectory of ReActis more grounded, fact-driven, and trustworthy, thanks to the
|
||
access of an external knowledge base.
|
||
B) While interleaving reasoning, action and observation steps improves ReAct’s grounded-
|
||
ness and trustworthiness, such a structural constraint also reduces its flexibility in formulating
|
||
reasoning steps, leading to more reasoning error rate than CoT. we note that there is one frequent
|
||
error pattern specific to ReAct, in which the model repetitively generates the previous thoughts and
|
||
actions, and we categorize it as part of “reasoning error” as the model fails to reason about what the
|
||
proper next action to take and jump out of the loop4.
|
||
C) For ReAct, successfully retrieving informative knowledge via search is critical. Non-
|
||
informative search, which counts for 23% of the error cases, derails the model reasoning and gives
|
||
it a hard time to recover and reformulate thoughts. This is perhaps an expected trade-off between
|
||
factuality and flexibility, which motivates our proposed strategies of combining two methods.
|
||
We provide examples for each success and failure modes in Appendix E.1. We also find some
|
||
HotpotQA questions may contain outdated answer labels, see Figure 4 for example.
|
||
ReAct + CoT-SC perform best for prompting LLMs
|
||
Also shown in Table 1, the best prompting
|
||
method on HotpotQA and Fever are ReAct →CoT-SC and CoT-SC →ReAct respectively.
|
||
Furthermore, Figure 2 shows how different methods perform with respect to the number of CoT-SC
|
||
samples used. While two ReAct + CoT-SC methods are advantageous at one task each, they both
|
||
significantly and consistently outperform CoT-SC across different number of samples, reaching
|
||
CoT-SC performance with 21 samples using merely 3-5 samples. These results indicate the value of
|
||
properly combining model internal knowledge and external knowledge for reasoning tasks.
|
||
ReAct performs best for fine-tuning
|
||
Figure 3 shows the scaling effect of prompting/finetuning
|
||
four methods (Standard, CoT, Act, ReAct) on HotpotQA. With PaLM-8/62B, prompting ReAct
|
||
performs worst among four methods due to the difficulty to learn both reasoning and acting from
|
||
in-context examples. However, when finetuned with just 3,000 examples, ReAct becomes the best
|
||
method among the four, with PaLM-8B finetuned ReAct outperforming all PaLM-62B prompting
|
||
methods, and PaLM-62B finetuned ReAct outperforming all 540B prompting methods. In contrast,
|
||
finetuning Standard or CoT is significantly worse than finetuning ReAct or Act for both PaLM-
|
||
8/62B, as the former essentially teaches models to memorize (potentially halluincated) knowledge
|
||
facts, and the latter teaches models how to (reason and) act to access information from Wikipedia, a
|
||
more generalizable skill for knowledge reasoning. As all prompting methods are still significantly
|
||
far from domain-specific state-of-the-art approaches (Table 1), we believe finetuning with more
|
||
human-written data might be a better way to unleash the power of ReAct.
|
||
4We suspect that this could be due to the sub-optimal greedy decoding procedure, and future work using
|
||
better decoding (e.g. beam search) might help address this issue.
|
||
6
|
||
|
||
--- Page 7 ---
|
||
Published as a conference paper at ICLR 2023
|
||
8b
|
||
62b
|
||
540b
|
||
size
|
||
0
|
||
5
|
||
10
|
||
15
|
||
20
|
||
25
|
||
30
|
||
HotpotQA EM
|
||
learning = prompt
|
||
8b
|
||
62b
|
||
540b
|
||
size
|
||
learning = finetune
|
||
Method
|
||
Standard
|
||
CoT
|
||
Act
|
||
ReAct
|
||
Figure 3: Scaling results for prompting and finetuning on HotPotQA with ReAct (ours) and baselines.
|
||
4
|
||
DECISION MAKING TASKS
|
||
We also test ReAct on two language-based interactive decision-making tasks, ALFWorld and
|
||
WebShop, both of which feature complex environments that require agents to act over long horizons
|
||
with sparse rewards, warranting the need for reasoning to act and explore effectively.
|
||
ALFWorld
|
||
ALFWorld (Shridhar et al., 2020b) (Figure 1(2)) is a synthetic text-based game designed
|
||
to align with the embodied ALFRED benchmark (Shridhar et al., 2020a). It includes 6 types of
|
||
tasks in which an agent needs to achieve a high-level goal (e.g. examine paper under desklamp) by
|
||
navigating and interacting with a simulated household via text actions (e.g. go to coffeetable 1, take
|
||
paper 2, use desklamp 1). A task instance can have more than 50 locations and take an expert policy
|
||
more than 50 steps to solve, thus challenging an agent to plan and track subgoals, as well as explore
|
||
systematically (e.g. check all desks one by one for desklamp). In particular, one challenge built into
|
||
ALFWorld is the need to determine likely locations for common household items (e.g. desklamps will
|
||
likely be on desks, shelfs, or dressers), making this environment a good fit for LLMs to exploit their
|
||
pretrained commonsense knowledge. To prompt ReAct, we randomly annotate three trajectories
|
||
from the training set for each task type, where each trajectory includes sparse thoughts that (1)
|
||
decompose the goal, (2) track subgoal completion, (3) determine the next subgoal, and (4) reason via
|
||
commonsense where to find an object and what to do with it. We show prompts used for ALFWorld
|
||
in Appendix C.4. Following Shridhar et al. (2020b), we evaluate on 134 unseen evaluation games
|
||
in a task-specific setup. For robustness, we construct 6 prompts for each task type through each
|
||
permutation of 2 annotated trajectories from the 3 we annotate. Act prompts are constructed using
|
||
the same trajectories, but without thoughts — since task instances are randomly chosen from the
|
||
training set, it favors neither ReAct nor Act and provides a fair and controlled comparison to test the
|
||
importance of sparse thoughts. For baselines, we use BUTLER (Shridhar et al., 2020b), an imitation
|
||
learning agent trained on 105 expert trajectories for each task type5.
|
||
WebShop
|
||
Can ReAct also interact with noisy real-world language environments for practical
|
||
applications? We investigate WebShop (Yao et al., 2022), a recently proposed online shopping
|
||
website environment with 1.18M real-world products and 12k human instructions. Unlike ALFWorld,
|
||
Webshop contains a high variety of structured and unstructured texts (e.g. product titles, descriptions,
|
||
and options crawled from Amazon), and requires an agent to purchase a product based on a user
|
||
instruction (e.g. “I am looking for a nightstand with drawers. It should have a nickel finish, and
|
||
priced lower than $140”) through web interactions (e.g. search “nightstand drawers”, choose buttons
|
||
such as “color: modern-nickel-white” or “back to search”). This task is evaluated by average score
|
||
(percentage of desired attributes covered by the chosen product averaged across all episodes) and
|
||
success rate (percentage of episodes where the chosen product satisfies all requirements) on 500 test
|
||
instructions. We formulate Act prompts with actions to search, choose product, choose options,
|
||
and buy, with ReAct prompts additionally reasoning to determine what to explore, when to buy,
|
||
and what products options are relevant to the instruction. See Table 6 for an example prompt, and
|
||
Table 10 for model predictions in the Appendix. We compare to an imitation learning (IL) method
|
||
5Micheli & Fleuret (2021) finetuned a GPT-2 model on 3553 task instances and achieved a much improved
|
||
performance than BUTLER, but it is trained on all task types, thus not included as a baseline.
|
||
7
|
||
|
||
--- Page 8 ---
|
||
Published as a conference paper at ICLR 2023
|
||
Method
|
||
Pick
|
||
Clean
|
||
Heat
|
||
Cool
|
||
Look
|
||
Pick 2
|
||
All
|
||
Act (best of 6)
|
||
88
|
||
42
|
||
74
|
||
67
|
||
72
|
||
41
|
||
45
|
||
ReAct (avg)
|
||
65
|
||
39
|
||
83
|
||
76
|
||
55
|
||
24
|
||
57
|
||
ReAct (best of 6)
|
||
92
|
||
58
|
||
96
|
||
86
|
||
78
|
||
41
|
||
71
|
||
ReAct-IM (avg)
|
||
55
|
||
59
|
||
60
|
||
55
|
||
23
|
||
24
|
||
48
|
||
ReAct-IM (best of 6)
|
||
62
|
||
68
|
||
87
|
||
57
|
||
39
|
||
33
|
||
53
|
||
BUTLERg (best of 8)
|
||
33
|
||
26
|
||
70
|
||
76
|
||
17
|
||
12
|
||
22
|
||
BUTLER (best of 8)
|
||
46
|
||
39
|
||
74
|
||
100
|
||
22
|
||
24
|
||
37
|
||
Table 3: AlfWorld task-specific success rates (%). BUTLER and
|
||
BUTLERg results are from Table 4 of Shridhar et al. (2020b). All
|
||
methods use greedy decoding, except that BUTLER uses beam search.
|
||
Method
|
||
Score
|
||
SR
|
||
Act
|
||
62.3
|
||
30.1
|
||
ReAct
|
||
66.6
|
||
40.0
|
||
IL
|
||
59.9
|
||
29.1
|
||
IL+RL
|
||
62.4
|
||
28.7
|
||
Human
|
||
82.1
|
||
59.6
|
||
Expert
|
||
Table 4: Score and suc-
|
||
cess rate (SR) on Web-
|
||
shop. IL/IL+RL taken
|
||
from Yao et al. (2022).
|
||
trained with 1,012 human annotated trajectories, and a imitation + reinforcement learning (IL + RL)
|
||
method additionally trained with 10,587 training instructions.
|
||
Results
|
||
ReAct outperforms Act on both ALFWorld (Table 3) and Webshop (Table 4). On
|
||
ALFWorld, the best ReAct trial achieves an average success rate of 71%, significantly outperforming
|
||
the best Act (45%) and BUTLER (37%) trials. In fact, even the worse ReAct trial (48%) beats
|
||
the best trial of both methods. Moreover, the advantage of ReAct over Act is consistent across
|
||
six controlled trials, with relative performance gain ranging from 33% to 90% and averaging 62%.
|
||
Qualitatively, we saw that, without any thoughts at all, Act fails to correctly decompose goals
|
||
into smaller subgoals, or loses track of the current state of the environment. Example trajectories
|
||
comparing ReAct and Act can be found in Appendix D.2.1 and Appendix D.2.2.
|
||
On Webshop, one-shot Act prompting already performs on par with IL and IL+RL methods. With
|
||
additional sparse reasoning, ReAct achieves significantly better performance, with an absolute 10%
|
||
improvement over the previous best success rate. By checking examples, we find that ReAct is more
|
||
likely to identify instruction-relevant products and options by reasoning to bridge the gap between
|
||
noisy observations and actions (e.g. “For ‘space-saving ottoman bench for living room’, the item
|
||
has options ‘39x18x18inch’ and ‘blue’ and seems good to buy.”). However, existing methods are
|
||
still far from the performance of expert humans (Table 4), who perform significantly more product
|
||
explorations and query re-formulations that are still challenging for prompting-based methods.
|
||
On the value of internal reasoning vs. external feedback
|
||
To our knowledge, ReAct is the first
|
||
demonstration of combined reasoning and action using an LLM applied to an interactive environment
|
||
within a closed-loop system. Perhaps the closest prior work is Inner Monologue (IM), from Huang
|
||
et al. (2022b), in which actions from an embodied agent are motivated by an eponymous “inner
|
||
monologue”. However, IM’s “inner monologue” is limited to observations of the environment
|
||
state and what needs to be completed by the agent for the goal to be satisfied. In contrast, the
|
||
reasoning traces in ReAct for decision making is flexible and sparse, allowing diverse reasoning
|
||
types (see Section 2) to be induced for different tasks.
|
||
To demonstrate the differences between ReAct and IM, and to highlight the importance of internal
|
||
reasoning vs. simple reactions to external feedback, we ran an ablation experiment using a thought
|
||
pattern composed of IM-like dense external feedback. As can be seen in Table 3, ReAct substantially
|
||
outperforms IM-style prompting (ReAct-IM) (71 vs. 53 overall success rate), with consistent
|
||
advantages on five out of six tasks. Qualitatively, we observed that ReAct-IM often made mistakes
|
||
in identifying when subgoals were finished, or what the next subgoal should be, due to a lack of high-
|
||
level goal decomposition. Additionally, many ReAct-IM trajectories struggled to determine where
|
||
an item would likely be within the ALFWorld environment, due to a lack of commonsense reasoning.
|
||
Both shortcomings can be addressed in the ReAct paradigm. More details about ReAct-IM is in
|
||
Appendix B.2. An example prompt for ReAct-IM can be found in Appendix C.4, and an example
|
||
trajectory in Appendix D.2.3.
|
||
8
|
||
|
||
--- Page 9 ---
|
||
Published as a conference paper at ICLR 2023
|
||
5
|
||
RELATED WORK
|
||
Language model for reasoning
|
||
Perhaps the most well-known work of using LLMs for reasoning
|
||
is Chain-of-Thought (CoT) (Wei et al., 2022), which reveals the ability of LLMs to formulate their
|
||
own “thinking procedure” for problem solving. Several follow-up works have since been performed,
|
||
including least-to-most prompting for solving complicated tasks (Zhou et al., 2022), zero-shot-
|
||
CoT (Kojima et al., 2022), and reasoning with self-consistency (Wang et al., 2022a). Recently,
|
||
(Madaan & Yazdanbakhsh, 2022) systematically studied the formulation and structure of CoT, and
|
||
observed that the presence of symbols, patterns and texts is crucial to the effectiveness of CoT. Other
|
||
work has also been extended to more sophisticated reasoning architecture beyond simple prompting.
|
||
For example Selection-Inference (Creswell et al., 2022) divides the reasoning process into two steps
|
||
of “selection” and “inference”. STaR (Zelikman et al., 2022) bootstraps the reasoning process by
|
||
finetuning the model on correct rationales generated by the model itself. Faithful reasoning (Creswell
|
||
& Shanahan, 2022) decomposes multi-step reasoning into three steps, each performed by a dedicated
|
||
LM respectively. Similar approaches like Scratchpad (Nye et al., 2021), which finetunes a LM on
|
||
intermediate computation steps, also demonstrate improvement on multi-step computation problems.
|
||
In contrast to these methods, ReAct performs more than just isolated, fixed reasoning, and integrates
|
||
model actions and their corresponding observations into a coherent stream of inputs for the model to
|
||
reason more accurately and tackle tasks beyond reasoning (e.g. interactive decision making).
|
||
Language model for decision making
|
||
The strong capability of LLMs has enabled them to perform
|
||
tasks beyond language generation, and it is becoming more popular to take advantage of LLMs as a
|
||
policy model for decision making, especially in interactive environments. WebGPT (Nakano et al.,
|
||
2021) uses an LM to interact with web browsers, navigate through web pages, and infer answers to
|
||
complicated questions from ELI5 (Fan et al., 2019). In comparison to ReAct, WebGPT does not
|
||
explicitly model the thinking and reasoning procedure, instead rely on expensive human feedback for
|
||
reinforcement learning. In conversation modeling, chatbots like BlenderBot (Shuster et al., 2022b)
|
||
and Sparrow (Glaese et al., 2022) and task-oriented dialogue systems like SimpleTOD (Hosseini-Asl
|
||
et al., 2020) also train LMs to make decision about API calls. Unlike ReAct, they do not explicitly
|
||
consider the reasoning procedure either, and also relies on expensive datasets and human feedback
|
||
collections for policy learning. In contrast, ReAct learns a policy in a much cheaper way, since the
|
||
decision making process only requires language description of the reasoning procedure.6
|
||
LLMS have also been increasingly employed in interactive and embodied environments for planning
|
||
and decision making. Perhaps most relevant to ReAct in this respect are SayCan (Ahn et al., 2022)
|
||
and Inner Monologue (Huang et al., 2022b), which use LLMs for robotic action planning and decision
|
||
making. In SayCan, LLMs were prompted to directly predict possible actions a robot can take, which
|
||
is then reranked by an affordance model grounded on the visual environments for final prediction.
|
||
Inner Monologue made further improvements by adding the eponymous “inner monologue", which is
|
||
implemented as injected feedback from the environment. To our knowledge, Inner Monologue is the
|
||
first work that demonstrates such a closed-loop system, which ReAct builds on. However, we argue
|
||
that Inner Monologue does not truly comprise of inner thoughts — this is elaborated in Section 4. We
|
||
also note that leveraging language as semantically-rich inputs in the process of interactive decision
|
||
making has been shown to be successful under other settings (Abramson et al., 2020; Karamcheti
|
||
et al., 2021; Huang et al., 2022a; Li et al., 2022). It is becoming more evident that with the help of
|
||
LLMs, language as a fundamental cognitive mechanism will play a critical role in interaction and
|
||
decision making. What is more, progress in LLMs has also inspired the development of versatile and
|
||
generalist agents like Reed et al. (2022).
|
||
6
|
||
CONCLUSION
|
||
We have proposed ReAct – a simple yet effective method for synergizing reasoning and acting in
|
||
large language models. Through a diverse set of experiments on multi-hop question-answering, fact
|
||
checking, and interactive decision-making tasks, we show that ReAct leads to superior performance
|
||
with interpretable decision traces. Despite the simplicity of our method, complex tasks with large
|
||
action spaces require more demonstrations to learn well, which unfortunately can easily go beyond
|
||
the input length limit of in-context learning. We explore the fine-tuning approach on HotpotQA
|
||
6Human feedback can also be incorporated in a complementary manner but we leave it for future work.
|
||
9
|
||
|
||
--- Page 10 ---
|
||
Published as a conference paper at ICLR 2023
|
||
with initial promising results, but learning from more high-quality human annotations will be the
|
||
desiderata to further improve the performance. Scaling up ReAct with multi-task training and
|
||
combining it with complementary paradigms like reinforcement learning could result in stronger
|
||
agents that further unlock the potential of LLMs for more applications.
|
||
ACKNOWLEDGMENTS
|
||
We thank the support and feedback of many people from Google Brain team and Princeton NLP
|
||
Group. This work was supported in part by the National Science Foundation under Grant No.
|
||
2107048. Any opinions, findings, and conclusions or recommendations expressed in this material are
|
||
those of the author(s) and do not necessarily reflect the views of the National Science Foundation.
|
||
REPRODUCIBILITY STATEMENT
|
||
Our main experiments are done on PaLM (Chowdhery et al., 2022), which is not an openly accessible
|
||
model yet. To increase reproducibility, we have included all used prompts in Appendix C, additional
|
||
experiments using GPT-3 (Brown et al., 2020) in Appendix A.1, and associated GPT-3 ReAct
|
||
prompting code at https://anonymous.4open.science/r/ReAct-2268/.
|
||
ETHICS STATEMENT
|
||
ReAct prompts large language models to generate more human interpretable, diagnosable, and
|
||
controllable task-solving trajectories than previous methods. However, hooking up a large language
|
||
model with an action space to interact with external environments (e.g. the web, physical environ-
|
||
ments) has potential dangers, e.g. looking up inappropriate or private information, or taking harmful
|
||
actions in an environment. Our experiments minimize such risks by limiting the interactions to
|
||
specific websites (Wikipedia or WebShop) that are free of private information, without any dangerous
|
||
actions in the action space design (i.e. models cannot really buy products on WebShop the research
|
||
benchmark, or edit Wikipedia). We believe researchers should be aware of such risks before designing
|
||
more extensive experiments in the future.
|
||
REFERENCES
|
||
Josh Abramson, Arun Ahuja, Iain Barr, Arthur Brussee, Federico Carnevale, Mary Cassin, Rachita
|
||
Chhaparia, Stephen Clark, Bogdan Damoc, Andrew Dudzik, Petko Georgiev, Aurelia Guy, Tim
|
||
Harley, Felix Hill, Alden Hung, Zachary Kenton, Jessica Landon, Timothy Lillicrap, Kory Mathew-
|
||
son, Soˇna Mokrá, Alistair Muldal, Adam Santoro, Nikolay Savinov, Vikrant Varma, Greg Wayne,
|
||
Duncan Williams, Nathaniel Wong, Chen Yan, and Rui Zhu. Imitating interactive intelligence,
|
||
2020. URL https://arxiv.org/abs/2012.05672.
|
||
Michael Ahn, Anthony Brohan, Noah Brown, Yevgen Chebotar, Omar Cortes, Byron David, Chelsea
|
||
Finn, Chuyuan Fu, Keerthana Gopalakrishnan, Karol Hausman, Alex Herzog, Daniel Ho, Jasmine
|
||
Hsu, Julian Ibarz, Brian Ichter, Alex Irpan, Eric Jang, Rosario Jauregui Ruano, Kyle Jeffrey, Sally
|
||
Jesmonth, Nikhil J Joshi, Ryan Julian, Dmitry Kalashnikov, Yuheng Kuang, Kuang-Huei Lee,
|
||
Sergey Levine, Yao Lu, Linda Luu, Carolina Parada, Peter Pastor, Jornell Quiambao, Kanishka
|
||
Rao, Jarek Rettinghouse, Diego Reyes, Pierre Sermanet, Nicolas Sievers, Clayton Tan, Alexander
|
||
Toshev, Vincent Vanhoucke, Fei Xia, Ted Xiao, Peng Xu, Sichun Xu, Mengyuan Yan, and
|
||
Andy Zeng. Do as i can, not as i say: Grounding language in robotic affordances, 2022. URL
|
||
https://arxiv.org/abs/2204.01691.
|
||
Ben Alderson-Day and Charles Fernyhough.
|
||
Inner speech: development, cognitive functions,
|
||
phenomenology, and neurobiology. Psychological bulletin, 141(5):931, 2015.
|
||
Alan Baddeley. Working memory. Science, 255(5044):556–559, 1992.
|
||
Tom Brown, Benjamin Mann, Nick Ryder, Melanie Subbiah, Jared D Kaplan, Prafulla Dhariwal,
|
||
Arvind Neelakantan, Pranav Shyam, Girish Sastry, Amanda Askell, et al. Language models are
|
||
few-shot learners. Advances in neural information processing systems, 33:1877–1901, 2020.
|
||
10
|
||
|
||
--- Page 11 ---
|
||
Published as a conference paper at ICLR 2023
|
||
Aakanksha Chowdhery, Sharan Narang, Jacob Devlin, Maarten Bosma, Gaurav Mishra, Adam
|
||
Roberts, Paul Barham, Hyung Won Chung, Charles Sutton, Sebastian Gehrmann, et al. Palm:
|
||
Scaling language modeling with pathways. arXiv preprint arXiv:2204.02311, 2022.
|
||
Antonia Creswell and Murray Shanahan. Faithful reasoning using large language models, 2022. URL
|
||
https://arxiv.org/abs/2208.14271.
|
||
Antonia Creswell, Murray Shanahan, and Irina Higgins. Selection-inference: Exploiting large
|
||
language models for interpretable logical reasoning, 2022. URL https://arxiv.org/abs/
|
||
2205.09712.
|
||
Angela Fan, Yacine Jernite, Ethan Perez, David Grangier, Jason Weston, and Michael Auli. ELI5:
|
||
Long form question answering. In Proceedings of the 57th Annual Meeting of the Association
|
||
for Computational Linguistics, pp. 3558–3567, Florence, Italy, July 2019. Association for Com-
|
||
putational Linguistics. doi: 10.18653/v1/P19-1346. URL https://aclanthology.org/
|
||
P19-1346.
|
||
Charles Fernyhough. Vygotsky, luria, and the social brain. Self and social regulation: Social
|
||
interaction and the development of social understanding and executive functions, pp. 56–79, 2010.
|
||
Amelia Glaese, Nat McAleese, Maja Trebacz, John Aslanides, Vlad Firoiu, Timo Ewalds, Mari-
|
||
beth Rauh, Laura Weidinger, Martin Chadwick, Phoebe Thacker, Lucy Campbell-Gillingham,
|
||
Jonathan Uesato, Po-Sen Huang, Ramona Comanescu, Fan Yang, Abigail See, Sumanth
|
||
Dathathri, Rory Greig, Charlie Chen, Doug Fritz, Jaume Sanchez Elias, Richard Green,
|
||
Soˇna Mokrá, Nicholas Fernando, Boxi Wu, Rachel Foley, Susannah Young, Iason Gabriel,
|
||
William Isaac, John Mellor, Demis Hassabis, Koray Kavukcuoglu, Lisa Anne Hendricks, and
|
||
Geoffrey Irving.
|
||
Improving alignment of dialogue agents via targeted human judgements,
|
||
2022.
|
||
URL https://storage.googleapis.com/deepmind-media/DeepMind.
|
||
com/Authors-Notes/sparrow/sparrow-final.pdf.
|
||
Ehsan Hosseini-Asl, Bryan McCann, Chien-Sheng Wu, Semih Yavuz, and Richard Socher. A simple
|
||
language model for task-oriented dialogue. Advances in Neural Information Processing Systems,
|
||
33:20179–20191, 2020.
|
||
Wenlong Huang, Pieter Abbeel, Deepak Pathak, and Igor Mordatch. Language models as zero-shot
|
||
planners: Extracting actionable knowledge for embodied agents. arXiv preprint arXiv:2201.07207,
|
||
2022a.
|
||
Wenlong Huang, Fei Xia, Ted Xiao, Harris Chan, Jacky Liang, Pete Florence, Andy Zeng, Jonathan
|
||
Tompson, Igor Mordatch, Yevgen Chebotar, et al. Inner monologue: Embodied reasoning through
|
||
planning with language models. arXiv preprint arXiv:2207.05608, 2022b.
|
||
Siddharth Karamcheti, Megha Srivastava, Percy Liang, and Dorsa Sadigh. Lila: Language-informed
|
||
latent actions. In CoRL, pp. 1379–1390, 2021. URL https://proceedings.mlr.press/
|
||
v164/karamcheti22a.html.
|
||
Takeshi Kojima, Shixiang Shane Gu, Machel Reid, Yutaka Matsuo, and Yusuke Iwasawa. Large
|
||
language models are zero-shot reasoners. arXiv preprint arXiv:2205.11916, 2022.
|
||
Angeliki Lazaridou, Elena Gribovskaya, Wojciech Stokowiec, and Nikolai Grigorev. Internet-
|
||
augmented language models through few-shot prompting for open-domain question answering.
|
||
arXiv preprint arXiv:2203.05115, 2022.
|
||
Patrick Lewis, Ethan Perez, Aleksandra Piktus, Fabio Petroni, Vladimir Karpukhin, Naman Goyal,
|
||
Heinrich Küttler, Mike Lewis, Wen-tau Yih, Tim Rocktäschel, et al. Retrieval-augmented genera-
|
||
tion for knowledge-intensive nlp tasks. Advances in Neural Information Processing Systems, 33:
|
||
9459–9474, 2020.
|
||
Shuang Li, Xavier Puig, Chris Paxton, Yilun Du, Clinton Wang, Linxi Fan, Tao Chen, De-An
|
||
Huang, Ekin Akyürek, Anima Anandkumar, Jacob Andreas, Igor Mordatch, Antonio Torralba,
|
||
and Yuke Zhu. Pre-trained language models for interactive decision-making, 2022. URL https:
|
||
//arxiv.org/abs/2202.01771.
|
||
11
|
||
|
||
--- Page 12 ---
|
||
Published as a conference paper at ICLR 2023
|
||
Aleksandr Romanovich Luria. Ls vygotsky and the problem of localization of functions. Neuropsy-
|
||
chologia, 3(4):387–392, 1965.
|
||
Aman Madaan and Amir Yazdanbakhsh. Text and patterns: For effective chain of thought, it takes
|
||
two to tango, 2022. URL https://arxiv.org/abs/2209.07686.
|
||
Vincent Micheli and François Fleuret. Language models are few-shot butlers. arXiv preprint
|
||
arXiv:2104.07972, 2021.
|
||
Reiichiro Nakano, Jacob Hilton, Suchir Balaji, Jeff Wu, Long Ouyang, Christina Kim, Christopher
|
||
Hesse, Shantanu Jain, Vineet Kosaraju, William Saunders, Xu Jiang, Karl Cobbe, Tyna Eloundou,
|
||
Gretchen Krueger, Kevin Button, Matthew Knight, Benjamin Chess, and John Schulman. Webgpt:
|
||
Browser-assisted question-answering with human feedback, 2021. URL https://arxiv.
|
||
org/abs/2112.09332.
|
||
Maxwell Nye, Anders Johan Andreassen, Guy Gur-Ari, Henryk Michalewski, Jacob Austin, David
|
||
Bieber, David Dohan, Aitor Lewkowycz, Maarten Bosma, David Luan, Charles Sutton, and
|
||
Augustus Odena. Show your work: Scratchpads for intermediate computation with language
|
||
models, 2021. URL https://arxiv.org/abs/2112.00114.
|
||
Scott Reed, Konrad Zolna, Emilio Parisotto, Sergio Gomez Colmenarejo, Alexander Novikov,
|
||
Gabriel Barth-Maron, Mai Gimenez, Yury Sulsky, Jackie Kay, Jost Tobias Springenberg, Tom
|
||
Eccles, Jake Bruce, Ali Razavi, Ashley Edwards, Nicolas Heess, Yutian Chen, Raia Hadsell,
|
||
Oriol Vinyals, Mahyar Bordbar, and Nando de Freitas. A generalist agent, 2022. URL https:
|
||
//arxiv.org/abs/2205.06175.
|
||
Mohit Shridhar, Jesse Thomason, Daniel Gordon, Yonatan Bisk, Winson Han, Roozbeh Mottaghi,
|
||
Luke Zettlemoyer, and Dieter Fox. Alfred: A benchmark for interpreting grounded instructions
|
||
for everyday tasks. In Proceedings of the IEEE/CVF conference on computer vision and pattern
|
||
recognition, pp. 10740–10749, 2020a.
|
||
Mohit Shridhar, Xingdi Yuan, Marc-Alexandre Côté, Yonatan Bisk, Adam Trischler, and Matthew
|
||
Hausknecht. Alfworld: Aligning text and embodied environments for interactive learning. arXiv
|
||
preprint arXiv:2010.03768, 2020b.
|
||
Kurt Shuster, Mojtaba Komeili, Leonard Adolphs, Stephen Roller, Arthur Szlam, and Jason Weston.
|
||
Language models that seek for knowledge: Modular search & generation for dialogue and prompt
|
||
completion. arXiv preprint arXiv:2203.13224, 2022a.
|
||
Kurt Shuster, Jing Xu, Mojtaba Komeili, Da Ju, Eric Michael Smith, Stephen Roller, Megan Ung,
|
||
Moya Chen, Kushal Arora, Joshua Lane, Morteza Behrooz, William Ngan, Spencer Poff, Naman
|
||
Goyal, Arthur Szlam, Y-Lan Boureau, Melanie Kambadur, and Jason Weston. Blenderbot 3:
|
||
a deployed conversational agent that continually learns to responsibly engage, 2022b. URL
|
||
https://arxiv.org/abs/2208.03188.
|
||
James Thorne, Andreas Vlachos, Christos Christodoulopoulos, and Arpit Mittal. Fever: a large-scale
|
||
dataset for fact extraction and verification. arXiv preprint arXiv:1803.05355, 2018.
|
||
Lev S Vygotsky. Thinking and speech. The collected works of LS Vygotsky, 1:39–285, 1987.
|
||
Xuezhi Wang, Jason Wei, Dale Schuurmans, Quoc Le, Ed Chi, Sharan Narang, Aakanksha Chowdh-
|
||
ery, and Denny Zhou. Self-consistency improves chain of thought reasoning in language models,
|
||
2022a. URL https://arxiv.org/abs/2203.11171.
|
||
Xuezhi Wang, Jason Wei, Dale Schuurmans, Quoc Le, Ed Chi, and Denny Zhou. Rationale-augmented
|
||
ensembles in language models. arXiv preprint arXiv:2207.00747, 2022b.
|
||
Jason Wei, Xuezhi Wang, Dale Schuurmans, Maarten Bosma, Ed Chi, Quoc Le, and Denny
|
||
Zhou. Chain of thought prompting elicits reasoning in large language models. arXiv preprint
|
||
arXiv:2201.11903, 2022.
|
||
Zhilin Yang, Peng Qi, Saizheng Zhang, Yoshua Bengio, William W Cohen, Ruslan Salakhutdinov,
|
||
and Christopher D Manning. Hotpotqa: A dataset for diverse, explainable multi-hop question
|
||
answering. arXiv preprint arXiv:1809.09600, 2018.
|
||
12
|
||
|
||
--- Page 13 ---
|
||
Published as a conference paper at ICLR 2023
|
||
Shunyu Yao, Rohan Rao, Matthew Hausknecht, and Karthik Narasimhan. Keep CALM and explore:
|
||
Language models for action generation in text-based games. In Proceedings of the 2020 Conference
|
||
on Empirical Methods in Natural Language Processing (EMNLP), pp. 8736–8754, Online, Novem-
|
||
ber 2020. Association for Computational Linguistics. doi: 10.18653/v1/2020.emnlp-main.704.
|
||
URL https://aclanthology.org/2020.emnlp-main.704.
|
||
Shunyu Yao, Howard Chen, John Yang, and Karthik Narasimhan. Webshop: Towards scalable
|
||
real-world web interaction with grounded language agents. arXiv preprint arXiv:2207.01206,
|
||
2022.
|
||
Eric Zelikman, Yuhuai Wu, Jesse Mu, and Noah D. Goodman. Star: Bootstrapping reasoning with
|
||
reasoning, 2022. URL https://arxiv.org/abs/2203.14465.
|
||
Denny Zhou, Nathanael Schärli, Le Hou, Jason Wei, Nathan Scales, Xuezhi Wang, Dale Schuurmans,
|
||
Olivier Bousquet, Quoc Le, and Ed Chi. Least-to-most prompting enables complex reasoning in
|
||
large language models, 2022. URL https://arxiv.org/abs/2205.10625.
|
||
Yunchang Zhu, Liang Pang, Yanyan Lan, Huawei Shen, and Xueqi Cheng. Adaptive information
|
||
seeking for open-domain question answering. arXiv preprint arXiv:2109.06747, 2021.
|
||
13
|
||
|
||
--- Page 14 ---
|
||
Published as a conference paper at ICLR 2023
|
||
A
|
||
ADDITIONAL RESULTS
|
||
A.1
|
||
GPT-3 EXPERIMENTS
|
||
PaLM-540B
|
||
GPT-3
|
||
HotpotQA (exact match)
|
||
29.4
|
||
30.8
|
||
ALFWorld (success rate %)
|
||
70.9
|
||
78.4
|
||
Table 5: ReAct prompting results using PaLM-540B vs. GPT-3 (text-davinci-002, greedy decoding).
|
||
On HotpotQA, we randomly sample a subset of 500 validation questions. On ALFWorld, we use all
|
||
134 unseen validation task instances, and use the best prompt set according to PaLM-540B.
|
||
We run additional GPT-3 (Brown et al., 2020) experiments to confirm ReAct prompting performance
|
||
is general across different large language models. As shown in Table 5, GPT-3 (text-davinci-002,
|
||
greedy decoding) consistently outperforms PaLM-540B on HotpotQA and ALFWorld, possibly
|
||
because it is finetuned with human instruction following. This indicates ReAct prompting is effective
|
||
across different large language models on different tasks. The code for these experiments are at
|
||
https://react-lm.github.io/.
|
||
A.2
|
||
REACT OBTAINS UP-TO-DATE KNOWLEDGE ON HOTPOTQA
|
||
D6WDQGDUG
|
||
$QVZHU
|
||
E&R75HDVRQ2QO\
|
||
7KRXJKW/HW
|
||
VWKLQNVWHS
|
||
E\VWHS7KHKRWHOWKDWLV
|
||
KRPHWRWKH&LUTXHGX
|
||
6ROHLOVKRZ0\VWHUHLV
|
||
7UHDVXUH,VODQG 7UHDVXUH
|
||
,VODQGKDVURRPVVR
|
||
WKHDQVZHULV
|
||
$QVZHU
|
||
F$FW2QO\
|
||
$FW6HDUFK>&LUTXHGX6ROHLO @
|
||
2EV&LUTXHGX6ROHLOLVD
|
||
&DQDGLDQHQWHUWDLQPHQWFRPSDQ\ª
|
||
$FW/RRNXS>0\VWHUH@
|
||
2EV1RPRUHUHVXOWV
|
||
$FW6HDUFK>0\VWHUH &LUTXHGX
|
||
6ROHLOVKRZ @
|
||
2EV&RXOGQRWILQGª
|
||
$FW6HDUFK>0\VWHUH&LUTXHGX
|
||
6ROHLO@
|
||
2EV0\VWqUHP\VWHHULV
|
||
RQHRIVL[ª
|
||
$FW/RRNXS>7UHDVXUH,VODQG
|
||
+RWHODQG&DVLQR@
|
||
ªªHQGZLWKRXWDQVZHU
|
||
G5H$FW5HDVRQ$FW
|
||
7KRXJKW,QHHGWRVHDUFK&LUTXHGX6ROHLOVKRZ0\VWHUH
|
||
|
||
ILQGWKHKRWHOLWLVLQWKHQILQGWKHQXPEHURIURRPVLQ
|
||
|
||
WKHKRWHO
|
||
$FW6HDUFK>&LUTXHGX6ROHLOVKRZ0\VWHUH @
|
||
2EV&RXOGQRWILQG&LUTXHGX6ROHLOVKRZ0\VWHUH
|
||
|
||
6LPLODU>
|
||
&LUTXHGX6ROHLO
|
||
ª
|
||
7KRXJKW7RILQGWKHKRWHO,FDQVHDUFK0\VWHUH&LUTXH
|
||
|
||
GX6ROHLO
|
||
$FW6HDUFK>0\VWHUH&LUTXHGX6ROHLO @
|
||
2EV0\VWqUHP\VWHHULVª +HOGLQDFXVWRPWKHDWUH DW
|
||
WKH7UHDVXUH,VODQG+RWHODQG&DVLQRª
|
||
7KRXJKW0\VWHUHLVKHOGLQDFXVWRPWKHDWUHDWWKH
|
||
7UHDVXUH,VODQG+RWHODQG&DVLQR6R,QHHGWRVHDUFK
|
||
|
||
7UHDVXUH,VODQG+RWHODQG&DVLQRQH[WDQGILQGWKHQXPEHU
|
||
|
||
RIURRPVLQWKHKRWHO
|
||
$FW6HDUFK>7UHDVXUH,VODQG+RWHODQG&DVLQR @
|
||
2EV7UHDVXUH ,VODQG+RWHODQG&DVLQRª ZLWKURRPV
|
||
DQGVXLWHVª
|
||
7KRXJKW7UHDVXUH,VODQG+RWHODQG&DVLQRKDVURRPV
|
||
|
||
DQGVXLWHV6RWKHDQVZHULV
|
||
$FW)LQLVK>@
|
||
Ҽ
|
||
4XHVWLRQ+RZPDQ\URRPVDUHLQWKHKRWHOWKDWLVKRPHWR
|
||
|
||
WKH&LUTXHGX6ROHLOVKRZ0\VWHUH"
|
||
+RWSRW4$ODEHO
|
||
+RWVSRW4$
|
||
2XWGDWHG
|
||
8SWRGDWH
|
||
Figure 4: Another example HotpotQA question, where the original label is outdated. Only ReAct is
|
||
able to obtain the up-to-date answer thanks to real-world web interaction plus reasoning.
|
||
During trajectory inspection, we also find that sometimes ReAct does not agree with dataset labels as
|
||
the labels themselves could be outdated. For example, as shown in Figure 4, the question asks about
|
||
the size of a hotel, which increased from the HotpotQA construction time. While Standard and CoT
|
||
give wrong answers due to hallucination, Act fails despite the access of real-world web interaction,
|
||
due to a lack of reasoning to guide how to interact with the Internet for QA. Only ReAct is able to
|
||
retrieve up-to-date information from the Internet and provide a reasonable answer. Therefore, better
|
||
incorporation of reasoning abilities might benefit recent Internet-augmented language models (Nakano
|
||
et al., 2021; Lazaridou et al., 2022; Shuster et al., 2022a) for up-to-date task solving.
|
||
A.3
|
||
HUMAN-IN-THE-LOOP BEHAVIOR CORRECTION ON ALFWORLD
|
||
We also explore human-in-the-loop interaction with ReAct, to allow a human to inspect and edit
|
||
ReAct’s reasoning traces. Figure 5 shows that by simply removing a hallucinating sentence in Act
|
||
17 and adding some hints in Act 23, ReAct can be made to change its behavior drastically to align
|
||
with these human thought edits and succeed in the task. From a human perspective, solving such a
|
||
task becomes significantly easier, from typing tens of actions to only editing a couple of thoughts,
|
||
which enables new forms of human-machine collaboration. We note that such a policy edit on-the-go
|
||
14
|
||
|
||
--- Page 15 ---
|
||
Published as a conference paper at ICLR 2023
|
||
D5H$FW
|
||
|
||
2EV<RXRSHQWKHGUDZHU7KHGUDZHULVRSHQ,QLW\RX
|
||
|
||
VHHDNH\FKDLQDQGDZDWFK
|
||
$FW7KLQN>1RZ,ILQGWKHILUVWNH\FKDLQ1H[W,QHHGWR
|
||
|
||
WDNHLW,FDQILQGWKHVHFRQGNH\FKDLQODWHULQGUDZHU
|
||
@
|
||
$FWWDNHNH\FKDLQIURPGUDZHU
|
||
2EV<RXSLFNXSWKHNH\FKDLQIURPWKHGUDZHU
|
||
|
||
|
||
$FWSXWNH\FKDLQLQRQVDIH
|
||
2EV<RXSXWWKHNH\FKDLQLQRQWKHVDIH
|
||
$FW7KLQN>1RZ,SXWWKHILUVWNH\FKDLQLQVDIH1H[W,QHHG
|
||
|
||
WRILQGWKHVHFRQGNH\FKDLQ,FDQGLUHFWO\JRWRGUDZHU
|
||
@
|
||
$FWJRWRGUDZHU
|
||
2EV7KHGUDZHULVRSHQ,QLW\RXVHHDZDWFK
|
||
|
||
$FW7KLQN>1RZ,ILQGWKHVHFRQGNH\FKDLQ1H[W,QHHG
|
||
|
||
WRWDNHLW @
|
||
$FWWDNHNH\FKDLQIURPGUDZHU
|
||
2EV1RWKLQJKDSSHQV
|
||
E5H$FW+XPDQ7KRXJKWHGLW
|
||
|
||
2EV<RXRSHQWKHGUDZHU7KHGUDZHULVRSHQ,QLW\RXVHHD
|
||
|
||
NH\FKDLQDQGDZDWFK
|
||
$FWѕ7KLQNѕ>1RZ,ILQGWKHILUVWNH\FKDLQ1H[W,QHHGWRWDNHLW
|
||
,
|
||
FDQILQGWKHVHFRQGNH\FKDLQODWHULQGUDZHU
|
||
@
|
||
$FWWDNHNH\FKDLQIURPGUDZHU
|
||
2EV<RXSLFNXSWKHNH\FKDLQIURPWKHGUDZHU
|
||
|
||
|
||
$FWSXWNH\FKDLQLQRQVDIH
|
||
2EV<RXSXWWKHNH\FKDLQLQRQWKHVDIH
|
||
$FW7KLQNѕ>1RZ,SXWWKHILUVWNH\FKDLQLQVDIH1H[W,QHHGWRILQG
|
||
|
||
WKHVHFRQGNH\FKDLQ ZKLFKLVPRUHOLNHO\WRDSSHDULQGUHVVHU
|
||
|
||
JDUEDJHFDQVDIHVLGHWDEOHVRIDVKHOI
|
||
@
|
||
$FWJRWRGUHVVHU
|
||
2EV2QWKHGUHVVHU\RXVHHDER[DFUHGLWFDUGDNH\FKDLQD
|
||
|
||
NH\FKDLQDODSWRS
|
||
$FW7KLQNѕ>1RZ,ILQGWKHVHFRQGNH\FKDLQ1H[W,QHHGWRWDNH
|
||
LW@
|
||
$FWWDNHNH\FKDLQIURPGUHVVHU
|
||
2EV<RXSLFNXSWKHNH\FKDLQIURPWKHGUHVVHU
|
||
|
||
$FW7KLQNѕ>1RZ,WDNHWKHVHFRQGNH\FKDLQ1H[W,QHHGWRSXWLW
|
||
LQRQVDIH @
|
||
$FWJRWRVDIH
|
||
2EV7KHVDIHLVRSHQ,QLW\RXVHHDNH\FKDLQDVWDWXHDQGD
|
||
|
||
ZDWFK
|
||
$FWSXWNH\FKDLQLQRQVDIH
|
||
2EV<RXSXWWKHNH\FKDLQLQRQWKHVDIH
|
||
Ҽ
|
||
<RXDUHLQWKHPLGGOHRIDURRP/RRNLQJTXLFNO\DURXQG\RX
|
||
|
||
\RXVHHDDUPFKDLUDFDELQHWªDFDELQHWDGUDZHU
|
||
|
||
ªDGUDZHUDGUHVVHUDJDUEDJHFDQDVDIHDVKHOI
|
||
|
||
ªDVKHOIDVLGHWDEOHDQGDVRID
|
||
|
||
<RXUWDVNLVWRSXWWZRNH\FKDLQLQVDIH
|
||
$OI:RUOG
|
||
Figure 5: A human-in-the-loop behavior correction example with ReAct in AlfWorld. (a) ReAct
|
||
trajectory fails due to a hallucinating thought (Act 17). (b) By a human simply editing two thoughts
|
||
(Act 17, 23), the ReAct trajectory produces desirable reasoning traces and actions and succeeds.
|
||
is difficult for Act and previous RL methods, as a human cannot change the model parameters, and
|
||
changing a few actions might not edit the rest of the model behavior. This paradigm is also more than
|
||
human dialogue to update the goal or subgoal as in Huang et al. (2022b) — while editing ReAct
|
||
thoughts can do these, it can also modify the model’s internal belief, reasoning styles, or anything the
|
||
flexible thought space supports, for better task solving. We believe this is an exciting direction for
|
||
human alignment and leave more systematic study as future work.
|
||
B
|
||
EXPERIMENT DETAILS
|
||
B.1
|
||
HOTPOTQA FINETUNING DETAILS
|
||
For all finetuning we use a batch size of 64. On PaLM-8B, we finetune ReAct and Act methods
|
||
for 4, 000 steps and Standard and CoT methods for 2, 000 steps. On PaLM-62B, we finetune
|
||
ReAct and Act methods for 4, 000 steps and Standard and CoT methods for 1, 000 steps. We
|
||
find ReAct and Act methods generally benefit from more training steps (and more training data),
|
||
while Standard and CoT methods degrade soon after finetuning.
|
||
B.2
|
||
ALFWORLD IM-STYLE DETAILS
|
||
For the IM-style ablation, the same expert trajectories used in ReAct are reannotated with dense
|
||
external feedback thoughts within these trajectories, that limit ReAct-IM to only think about (1)
|
||
decomposing the current goal and (2) the current subgoal that needs to be completed. In particular,
|
||
ReAct-IM lacks thoughts that (1) determine when a subgoal is completed (2) determine what the
|
||
next subgoal should be (3) inducing the LLM to refer to its internal pretraining knowledge to identify
|
||
where items can be within the environment.
|
||
15
|
||
|
||
--- Page 16 ---
|
||
Published as a conference paper at ICLR 2023
|
||
C
|
||
PROMPTS
|
||
C.1
|
||
HOTPOTQA
|
||
Hotpot QA Prompts
|
||
Original
|
||
Question
|
||
What is the elevation range for the area that the eastern sector of the
|
||
Colorado orogeny extends into?
|
||
Answer
|
||
1,800 to 7,000 ft
|
||
Question
|
||
Musician and satirist Allie Goertz wrote a song about the "The Simpsons"
|
||
character Milhouse, who Matt Groening named after who?
|
||
Answer
|
||
Richard Nixon
|
||
Question
|
||
Which documentary is about Finnish rock groups, Adam Clayton Powell or The
|
||
Saimaa Gesture?
|
||
Answer
|
||
The Saimaa Gesture
|
||
Question
|
||
What profession does Nicholas Ray and Elia Kazan have in common?
|
||
Answer
|
||
director, screenwriter, actor
|
||
Question
|
||
Which magazine was started first Arthur’s Magazine or First for Women?
|
||
Answer
|
||
Arthur’s Magazine
|
||
Question
|
||
Were Pavel Urysohn and Leonid Levin known for the same type of work?
|
||
Answer
|
||
Yes
|
||
Act
|
||
Question
|
||
What is the elevation range for the area that the eastern sector of the
|
||
Colorado orogeny extends into?
|
||
Action 1
|
||
Search[Colorado orogeny]
|
||
Observation 1
|
||
The Colorado orogeny was an episode of mountain building (an orogeny) in
|
||
Colorado and surrounding areas.
|
||
Action 2
|
||
Lookup[eastern sector]
|
||
Observation 2
|
||
(Result 1 / 1) The eastern sector extends into the High Plains and is called
|
||
the Central Plains orogeny.
|
||
Action 3
|
||
Search[High Plains]
|
||
Observation 3
|
||
High Plains refers to one of two distinct land regions:
|
||
Action 4
|
||
Search[High Plains (United States)]
|
||
Observation 4
|
||
The High Plains are a subregion of the Great Plains.
|
||
From east to west, the
|
||
High Plains rise in elevation from around 1,800 to 7,000 ft (550 to 2,130
|
||
m).[3]
|
||
Action 5
|
||
Finish[1,800 to 7,000 ft]
|
||
Question
|
||
Musician and satirist Allie Goertz wrote a song about the "The Simpsons"
|
||
character Milhouse, who Matt Groening named after who?
|
||
Action 1
|
||
Search[Milhouse]
|
||
Observation 1
|
||
Milhouse Mussolini Van Houten is a recurring character in the Fox animated
|
||
television series The Simpsons voiced by Pamela Hayden and created by Matt
|
||
Groening.
|
||
Action 2
|
||
Lookup[named after]
|
||
Observation 2
|
||
(Result 1 / 1) Milhouse was named after U.S. president Richard Nixon, whose
|
||
middle name was Milhous.
|
||
Action 3
|
||
Finish[Richard Nixon]
|
||
Question
|
||
Which documentary is about Finnish rock groups, Adam Clayton Powell or The
|
||
Saimaa Gesture?
|
||
Action 1
|
||
Search[Adam Clayton Powell]
|
||
Observation 1
|
||
Could not find [Adam Clayton Powell].
|
||
Similar:
|
||
[’Adam Clayton Powell
|
||
III’, ’Seventh Avenue (Manhattan)’, ’Adam Clayton Powell Jr.
|
||
State Office
|
||
Building’, ’Isabel Washington Powell’, ’Adam Powell’, ’Adam Clayton Powell
|
||
(film)’, ’Giancarlo Esposito’].
|
||
Action 2
|
||
Search[Adam Clayton Powell (film)]
|
||
Observation 2
|
||
Adam Clayton Powell is a 1989 American documentary film directed by
|
||
Richard Kilberg.
|
||
The film is about the rise and fall of influential
|
||
African-American politician Adam Clayton Powell Jr.[3][4] It was later aired
|
||
as part of the PBS series The American Experience.
|
||
Action 3
|
||
Finish[The Saimaa Gesture]
|
||
Question
|
||
What profession does Nicholas Ray and Elia Kazan have in common?
|
||
Action 1
|
||
Search[Nicholas Ray]
|
||
Observation 1
|
||
Nicholas Ray (born Raymond Nicholas Kienzle Jr., August 7, 1911 - June 16,
|
||
1979) was an American film director, screenwriter, and actor best known for
|
||
the 1955 film Rebel Without a Cause.
|
||
Action 2
|
||
Search[Elia Kazan]
|
||
Observation 2
|
||
Elia Kazan was an American film and theatre director, producer, screenwriter
|
||
and actor.
|
||
Continued on next page
|
||
16
|
||
|
||
--- Page 17 ---
|
||
Published as a conference paper at ICLR 2023
|
||
Hotpot QA Prompts – Continued from previous page
|
||
Action 3
|
||
Finish[director, screenwriter, actor]
|
||
Question
|
||
Which magazine was started first Arthur’s Magazine or First for Women?
|
||
Action 1
|
||
Search[Arthur’s Magazine]
|
||
Observation 1
|
||
Arthur’s Magazine (1844-1846) was an American literary periodical published
|
||
in Philadelphia in the 19th century.
|
||
Action 2
|
||
Search[First for Women]
|
||
Observation 2
|
||
First for Women is a woman’s magazine published by Bauer Media Group in the
|
||
USA.[1] The magazine was started in 1989.
|
||
Action 3
|
||
Finish[Arthur’s Magazine]
|
||
Question
|
||
Were Pavel Urysohn and Leonid Levin known for the same type of work?
|
||
Action 1
|
||
Search[Pavel Urysohn]
|
||
Observation 1
|
||
Pavel Samuilovich Urysohn (February 3, 1898 - August 17, 1924) was a Soviet
|
||
mathematician who is best known for his contributions in dimension theory.
|
||
Action 2
|
||
Search[Leonid Levin]
|
||
Observation 2
|
||
Leonid Anatolievich Levin is a Soviet-American mathematician and computer
|
||
scientist.
|
||
Action 3
|
||
Finish[yes]
|
||
CoT
|
||
Question
|
||
What is the elevation range for the area that the eastern sector of the
|
||
Colorado orogeny extends into?
|
||
Thought
|
||
Let’s think step by step.
|
||
The eastern sector of Colorado orogeny extends
|
||
into the High Plains.
|
||
High Plains rise in elevation from around 1,800 to
|
||
7,000 ft, so the answer is 1,800 to 7,000 ft.
|
||
Answer
|
||
1,800 to 7,000 ft
|
||
Question
|
||
Musician and satirist Allie Goertz wrote a song about the "The Simpsons"
|
||
character Milhouse, who Matt Groening named after who?
|
||
Thought
|
||
Let’s think step by step.
|
||
Milhouse was named after U.S. president Richard
|
||
Nixon, so the answer is Richard Nixon.
|
||
Answer
|
||
Richard Nixon
|
||
Question
|
||
Which documentary is about Finnish rock groups, Adam Clayton Powell or The
|
||
Saimaa Gesture?
|
||
Thought
|
||
Let’s think step by step.
|
||
Adam Clayton Powell (film) is a documentary about
|
||
an African-American politician, not Finnish rock groups.
|
||
So the documentary
|
||
about Finnish rock groups must instead be The Saimaa Gesture.
|
||
Answer
|
||
The Saimaa Gesture
|
||
Question
|
||
What profession does Nicholas Ray and Elia Kazan have in common?
|
||
Thought
|
||
Let’s think step by step.
|
||
Professions of Nicholas Ray are director,
|
||
screenwriter, and actor.
|
||
Professions of Elia Kazan are director, producer,
|
||
screenwriter, and actor.
|
||
So profession Nicholas Ray and Elia Kazan have in
|
||
common is director, screenwriter, and actor.
|
||
Answer
|
||
director, screenwriter, actor
|
||
Question
|
||
Which magazine was started first Arthur’s Magazine or First for Women?
|
||
Thought
|
||
Let’s think step by step.
|
||
Arthur’s Magazine was started in 1844.
|
||
First
|
||
for Women was started in 1989.
|
||
1844 (Arthur’s Magazine) < 1989 (First for
|
||
Women), so Arthur’s Magazine was started first.
|
||
Answer
|
||
Arthur’s Magazine
|
||
Question
|
||
Were Pavel Urysohn and Leonid Levin known for the same type of work?
|
||
Thought
|
||
Let’s think step by step.
|
||
Pavel Urysohn is a mathematician.
|
||
Leonid Levin
|
||
is a mathematician and computer scientist.
|
||
So Pavel Urysohn and Leonid
|
||
Levin have the same type of work.
|
||
Answer
|
||
Yes
|
||
ReAct
|
||
Question
|
||
What is the elevation range for the area that the eastern sector of the
|
||
Colorado orogeny extends into?
|
||
Thought 1
|
||
I need to search Colorado orogeny, find the area that the eastern sector
|
||
of the Colorado orogeny extends into, then find the elevation range of the
|
||
area.
|
||
Action 1
|
||
Search[Colorado orogeny]
|
||
Observation 1
|
||
The Colorado orogeny was an episode of mountain building (an orogeny) in
|
||
Colorado and surrounding areas.
|
||
Thought 2
|
||
It does not mention the eastern sector.
|
||
So I need to look up eastern
|
||
sector.
|
||
Action 2
|
||
Lookup[eastern sector]
|
||
Observation 2
|
||
(Result 1 / 1) The eastern sector extends into the High Plains and is called
|
||
the Central Plains orogeny.
|
||
Thought 3
|
||
The eastern sector of Colorado orogeny extends into the High Plains.
|
||
So I
|
||
need to search High Plains and find its elevation range.
|
||
Action 3
|
||
Search[High Plains]
|
||
Observation 3
|
||
High Plains refers to one of two distinct land regions
|
||
Thought 4
|
||
I need to instead search High Plains (United States).
|
||
Action 4
|
||
Search[High Plains (United States)]
|
||
Continued on next page
|
||
17
|
||
|
||
--- Page 18 ---
|
||
Published as a conference paper at ICLR 2023
|
||
Hotpot QA Prompts – Continued from previous page
|
||
Observation 4
|
||
The High Plains are a subregion of the Great Plains.
|
||
From east to west, the
|
||
High Plains rise in elevation from around 1,800 to 7,000 ft (550 to 2,130
|
||
m).[3]
|
||
Thought 5
|
||
High Plains rise in elevation from around 1,800 to 7,000 ft, so the answer
|
||
is 1,800 to 7,000 ft.
|
||
Action 5
|
||
Finish[1,800 to 7,000 ft]
|
||
Question
|
||
Musician and satirist Allie Goertz wrote a song about the "The Simpsons"
|
||
character Milhouse, who Matt Groening named after who?
|
||
Thought 1
|
||
The question simplifies to "The Simpsons" character Milhouse is named after
|
||
who.
|
||
I only need to search Milhouse and find who it is named after.
|
||
Action 1
|
||
Search[Milhouse]
|
||
Observation 1
|
||
Milhouse Mussolini Van Houten is a recurring character in the Fox animated
|
||
television series The Simpsons voiced by Pamela Hayden and created by Matt
|
||
Groening.
|
||
Thought 2
|
||
The paragraph does not tell who Milhouse is named after, maybe I can look up
|
||
"named after".
|
||
Action 2
|
||
Lookup[named after]
|
||
Observation 2
|
||
(Result 1 / 1) Milhouse was named after U.S. president Richard Nixon, whose
|
||
middle name was Milhous.
|
||
Thought 3
|
||
Milhouse was named after U.S. president Richard Nixon, so the answer is
|
||
Richard Nixon.
|
||
Action 3
|
||
Finish[Richard Nixon]
|
||
Question
|
||
Which documentary is about Finnish rock groups, Adam Clayton Powell or The
|
||
Saimaa Gesture?
|
||
Thought 1
|
||
I need to search Adam Clayton Powell and The Saimaa Gesture, and find which
|
||
documentary is about Finnish rock groups.
|
||
Action 1
|
||
Search[Adam Clayton Powell]
|
||
Observation 1
|
||
Could not find [Adam Clayton Powell].
|
||
Similar:
|
||
[’Adam Clayton Powell
|
||
III’, ’Seventh Avenue (Manhattan)’, ’Adam Clayton Powell Jr.
|
||
State Office
|
||
Building’, ’Isabel Washington Powell’, ’Adam Powell’, ’Adam Clayton Powell
|
||
(film)’, ’Giancarlo Esposito’].
|
||
Thought 2
|
||
To find the documentary, I can search Adam Clayton Powell (film).
|
||
Action 2
|
||
Search[Adam Clayton Powell (film)]
|
||
Observation 2
|
||
Adam Clayton Powell is a 1989 American documentary film directed by
|
||
Richard Kilberg.
|
||
The film is about the rise and fall of influential
|
||
African-American politician Adam Clayton Powell Jr.[3][4] It was later aired
|
||
as part of the PBS series The American Experience.
|
||
Thought 3
|
||
Adam Clayton Powell (film) is a documentary about an African-American
|
||
politician, not Finnish rock groups.
|
||
So the documentary about Finnish rock
|
||
groups must instead be The Saimaa Gesture.
|
||
Action 3
|
||
Finish[The Saimaa Gesture]
|
||
Question
|
||
What profession does Nicholas Ray and Elia Kazan have in common?
|
||
Thought 1
|
||
I need to search Nicholas Ray and Elia Kazan, find their professions, then
|
||
find the profession they have in common.
|
||
Action 1
|
||
Search[Nicholas Ray]
|
||
Observation 1
|
||
Nicholas Ray (born Raymond Nicholas Kienzle Jr., August 7, 1911 - June 16,
|
||
1979) was an American film director, screenwriter, and actor best known for
|
||
the 1955 film Rebel Without a Cause.
|
||
Thought 2
|
||
Professions of Nicholas Ray are director, screenwriter, and actor.
|
||
I need
|
||
to search Elia Kazan next and find his professions.
|
||
Action 2
|
||
Search[Elia Kazan]
|
||
Observation 2
|
||
Elia Kazan was an American film and theatre director, producer, screenwriter
|
||
and actor.
|
||
Thought 3
|
||
Professions of Elia Kazan are director, producer, screenwriter, and actor.
|
||
So profession Nicholas Ray and Elia Kazan have in common is director,
|
||
screenwriter, and actor.
|
||
Action 3
|
||
Finish[director, screenwriter, actor]
|
||
Question
|
||
Which magazine was started first Arthur’s Magazine or First for Women?
|
||
Thought 1
|
||
I need to search Arthur’s Magazine and First for Women, and find which was
|
||
started first.
|
||
Action 1
|
||
Search[Arthur’s Magazine]
|
||
Observation 1
|
||
Arthur’s Magazine (1844-1846) was an American literary periodical published
|
||
in Philadelphia in the 19th century.
|
||
Thought 2
|
||
Arthur’s Magazine was started in 1844.
|
||
I need to search First for Women
|
||
next.
|
||
Action 2
|
||
Search[First for Women]
|
||
Observation 2
|
||
First for Women is a woman’s magazine published by Bauer Media Group in the
|
||
USA.[1] The magazine was started in 1989.
|
||
Thought 3
|
||
First for Women was started in 1989.
|
||
1844 (Arthur’s Magazine) < 1989 (First
|
||
for Women), so Arthur’s Magazine was started first.
|
||
Action 3
|
||
Finish[Arthur’s Magazine]
|
||
Question
|
||
Were Pavel Urysohn and Leonid Levin known for the same type of work?
|
||
Thought 1
|
||
I need to search Pavel Urysohn and Leonid Levin, find their types of work,
|
||
then find if they are the same.
|
||
Action 1
|
||
Search[Pavel Urysohn]
|
||
Continued on next page
|
||
18
|
||
|
||
--- Page 19 ---
|
||
Published as a conference paper at ICLR 2023
|
||
Hotpot QA Prompts – Continued from previous page
|
||
Observation 1
|
||
Pavel Samuilovich Urysohn (February 3, 1898 - August 17, 1924) was a Soviet
|
||
mathematician who is best known for his contributions in dimension theory.
|
||
Thought 2
|
||
Pavel Urysohn is a mathematician.
|
||
I need to search Leonid Levin next and
|
||
find its type of work.
|
||
Action 2
|
||
Search[Leonid Levin]
|
||
Observation 2
|
||
Leonid Anatolievich Levin is a Soviet-American mathematician and computer
|
||
scientist.
|
||
Thought 3
|
||
Leonid Levin is a mathematician and computer scientist.
|
||
So Pavel Urysohn
|
||
and Leonid Levin have the same type of work.
|
||
Action 3
|
||
Finish[yes]
|
||
19
|
||
|
||
--- Page 20 ---
|
||
Published as a conference paper at ICLR 2023
|
||
C.2
|
||
FEVER
|
||
FEVER Prompts
|
||
Original
|
||
Determine if there is Observation that SUPPORTS or REFUTES a Claim, or if
|
||
there is NOT ENOUGH INFORMATION.
|
||
Claim
|
||
Nikolaj Coster-Waldau worked with the Fox Broadcasting Company.
|
||
Answer
|
||
SUPPORTS
|
||
Claim
|
||
Stranger Things is set in Bloomington, Indiana.
|
||
Answer
|
||
REFUTES
|
||
Claim
|
||
Beautiful reached number two on the Billboard Hot 100 in 2003.
|
||
Answer
|
||
NOT ENOUGH INFO
|
||
Act
|
||
Determine if there is Observation that SUPPORTS or REFUTES a Claim, or if
|
||
there is NOT ENOUGH INFORMATION.
|
||
Claim
|
||
Nikolaj Coster-Waldau worked with the Fox Broadcasting Company.
|
||
Action2
|
||
Search[Nikolaj Coster-Waldau]
|
||
Observation 1
|
||
Nikolaj William Coster-Waldau (born 27 July 1970) is a Danish actor and
|
||
producer.
|
||
He graduated from the Danish National School of Performing Arts
|
||
in Copenhagen in 1993,[1] and had his breakthrough role in Denmark with
|
||
the film Nightwatch (1994).
|
||
He played Jaime Lannister in the HBO fantasy
|
||
drama series Game of Thrones, for which he received two Primetime Emmy
|
||
Award nominations for Outstanding Supporting Actor in a Drama Series..
|
||
Coster-Waldau has appeared in numerous films in his native Denmark and
|
||
Scandinavia, including Headhunters (2011) and A Thousand Times Good Night
|
||
(2013).
|
||
In the U.S, his debut film role was in the war film Black Hawk Down
|
||
(2001), playing Medal of Honor recipient Gary Gordon.[2] He then played a
|
||
detective in the short-lived Fox television series New Amsterdam (2008), and
|
||
appeared in the 2009 Fox television film Virtuality, originally intended as
|
||
a pilot.
|
||
Action 2
|
||
Finish[SUPPORTS]
|
||
Claim
|
||
Stranger Things is set in Bloomington, Indiana.
|
||
Action 1
|
||
Search[Stranger Things]
|
||
Observation 1
|
||
Stranger Things is an American science fiction horror drama television
|
||
series created by the Duffer Brothers.
|
||
Set in the 1980s, primarily in
|
||
the fictional town of Hawkins, Indiana, the series centers on a number of
|
||
mysteries and supernatural events occurring around the town and their impact
|
||
on an ensemble of child and adult characters.
|
||
Action 2
|
||
Finish[REFUTES]
|
||
Claim
|
||
Beautiful reached number two on the Billboard Hot 100 in 2003.
|
||
Action 1
|
||
Search[Beautiful]
|
||
Observation 1
|
||
Could not find [Beautiful].
|
||
Similar:
|
||
[’Beautiful’, ’Beautiful, Beautiful’,
|
||
’A Beautiful Mind (film)’, ’Beautiful (Christina Aguilera song)’, ’Life Is
|
||
Beautiful’].
|
||
Action 2
|
||
Search[Beautiful (Christina Aguilera song)
|
||
Observation 2
|
||
"Beautiful" is a song recorded by American singer Christina Aguilera for her
|
||
fourth studio album, Stripped (2002).
|
||
Action 3
|
||
Lookup[Billboard Hot 100]
|
||
Observation 3
|
||
(Result 1 / 3) The song peaked at number two on the Billboard Hot 100 in the
|
||
United States, where it was certified Gold for 500,000 units shipped.
|
||
Action 4
|
||
Finish[NOT ENOUGH INFO]
|
||
CoT
|
||
Determine if there is Observation that SUPPORTS or REFUTES a Claim, or if
|
||
there is NOT ENOUGH INFORMATION.
|
||
Claim
|
||
Nikolaj Coster-Waldau worked with the Fox Broadcasting Company.
|
||
Thought
|
||
Nikolaj William Coster-Waldau appeared in the 2009 Fox television film
|
||
Virtuality, so he has worked with the Fox Broadcasting Company.
|
||
Answer
|
||
SUPPORTS
|
||
Claim
|
||
Stranger Things is set in Bloomington, Indiana.
|
||
Thought
|
||
Stranger Things is in the fictional town of Hawkins, Indiana, not in
|
||
Bloomington, Indiana.
|
||
Answer
|
||
REFUTES
|
||
Continued on next page
|
||
20
|
||
|
||
--- Page 21 ---
|
||
Published as a conference paper at ICLR 2023
|
||
Fever Prompts – Continued from previous page
|
||
Claim
|
||
Beautiful reached number two on the Billboard Hot 100 in 2003.
|
||
Thought
|
||
The song peaked at number two on the Billboard Hot 100 in the United States,
|
||
but not sure if it was in 2003.
|
||
Answer
|
||
NOT ENOUGH INFO
|
||
ReAct
|
||
Determine if there is Observation that SUPPORTS or REFUTES a Claim, or if
|
||
there is NOT ENOUGH INFORMATION.
|
||
Claim
|
||
Nikolaj Coster-Waldau worked with the Fox Broadcasting Company.
|
||
Thought 1
|
||
I need to search Nikolaj Coster-Waldau and find if he has worked with the
|
||
Fox Broadcasting Company.
|
||
Action 1
|
||
Search[Nikolaj Coster-Waldau]
|
||
Observation 1
|
||
Nikolaj William Coster-Waldau (born 27 July 1970) is a Danish actor and
|
||
producer.
|
||
He graduated from the Danish National School of Performing Arts
|
||
in Copenhagen in 1993,[1] and had his breakthrough role in Denmark with
|
||
the film Nightwatch (1994).
|
||
He played Jaime Lannister in the HBO fantasy
|
||
drama series Game of Thrones, for which he received two Primetime Emmy
|
||
Award nominations for Outstanding Supporting Actor in a Drama Series..
|
||
Coster-Waldau has appeared in numerous films in his native Denmark and
|
||
Scandinavia, including Headhunters (2011) and A Thousand Times Good Night
|
||
(2013).
|
||
In the U.S, his debut film role was in the war film Black Hawk Down
|
||
(2001), playing Medal of Honor recipient Gary Gordon.[2] He then played a
|
||
detective in the short-lived Fox television series New Amsterdam (2008), and
|
||
appeared in the 2009 Fox television film Virtuality, originally intended as
|
||
a pilot.
|
||
Thought 2
|
||
Because he "appeared in the 2009 Fox television film Virtuality", he should
|
||
have worked with the Fox Broadcasting Company.
|
||
Action 2
|
||
Finish[SUPPORTS]
|
||
Claim
|
||
Stranger Things is set in Bloomington, Indiana.
|
||
Thought 1
|
||
I should search for Stranger Things, and see if it is set in Bloomington,
|
||
Indiana.
|
||
Action 1
|
||
Search[Stranger Things]
|
||
Observation 1
|
||
Stranger Things is an American science fiction horror drama television
|
||
series created by the Duffer Brothers.
|
||
Set in the 1980s, primarily in
|
||
the fictional town of Hawkins, Indiana, the series centers on a number of
|
||
mysteries and supernatural events occurring around the town and their impact
|
||
on an ensemble of child and adult characters.
|
||
Thought 2
|
||
The observation says that it is set in a "fictional town of Hawkins,
|
||
Indiana", so it is not set in Bloomington.
|
||
Action 2
|
||
Finish[REFUTES]
|
||
Claim
|
||
Beautiful reached number two on the Billboard Hot 100 in 2003.
|
||
Thought 1
|
||
I need to search the song Beautiful and find if it reached number two on the
|
||
Billboard Hot 100 in 2003.
|
||
Action 1
|
||
Search[Beautiful]
|
||
Observation 1
|
||
Could not find [Beautiful].
|
||
Similar:
|
||
[’Beautiful’, ’Beautiful, Beautiful’,
|
||
’A Beautiful Mind (film)’, ’Beautiful (Christina Aguilera song)’, ’Life Is
|
||
Beautiful’].
|
||
Thought 2
|
||
From suggestions, I should search "Beautiful (Christina Aguilera song)" to
|
||
find the song.
|
||
Action 2
|
||
Search[Beautiful (Christina Aguilera song)]
|
||
Observation 2
|
||
"Beautiful" is a song recorded by American singer Christina Aguilera for her
|
||
fourth studio album, Stripped (2002).
|
||
Thought 3
|
||
It does not mention Billboard, so I need to look up "Billboard Hot 100" to
|
||
find if it reached number two on it in 2003.
|
||
Action 3
|
||
Lookup[Billboard Hot 100]
|
||
Observation 3
|
||
(Result 1 / 3) The song peaked at number two on the Billboard Hot 100 in the
|
||
United States, where it was certified Gold for 500,000 units shipped.
|
||
Thought 4
|
||
It only says the song peaked at number two on the Billboard Hot 100, but not
|
||
if it was in 2003.
|
||
I am not sure if this claim is true or not.
|
||
Action 4
|
||
Finish[NOT ENOUGH INFO]
|
||
21
|
||
|
||
--- Page 22 ---
|
||
Published as a conference paper at ICLR 2023
|
||
C.3
|
||
WEBSHOP
|
||
Table 6: Prompts used for the Webshop experiments in Section 4. We use the prompt on the left for
|
||
Act, and use the prompt on the right (add reasoning) for ReAct.
|
||
Instruction: i would like a 3 ounce bottle of bright citrus deodorant for sensitive skin, and price lower than 50.00 dollars
|
||
Act
|
||
ReAct
|
||
Action: search
|
||
|
||
3 ounce bright citrus deodorant sensitive skin
|
||
|
||
Observation:
|
||
|
||
Back to Search
|
||
|
||
Page 1 (Total results: 50)
|
||
|
||
Next
|
||
|
||
|
||
B078GWRC1J
|
||
|
||
Bright Citrus Deodorant by Earth Mama | Natural and Safe for
|
||
Sensitive Skin, Pregnancy and Breastfeeding, Contains Organic
|
||
Calendula 3-Ounce
|
||
$10.99
|
||
|
||
B078GTKVXY
|
||
|
||
Ginger Fresh Deodorant by Earth Mama | Natural and Safe for
|
||
Sensitive Skin, Pregnancy and Breastfeeding, Contains Organic
|
||
Calendula 3-Ounce
|
||
$10.99
|
||
|
||
B08KBVJ4XN
|
||
|
||
Barrel and Oak - Aluminum-Free Deodorant, Deodorant for Men
|
||
, Essential Oil-Based Scent, 24-Hour Odor Protection, Cedar
|
||
& Patchouli Blend, Gentle on Sensitive Skin (Mountain Sage,
|
||
2.7 oz, 2-Pack)
|
||
$15.95
|
||
Action: click
|
||
|
||
B078GWRC1J
|
||
|
||
Observation:
|
||
|
||
Back to Search
|
||
|
||
|
||
Prev
|
||
|
||
scent [assorted scents][bright citrus][calming lavender][ginger
|
||
[fresh] simply non-scents]
|
||
size [travel set (4-pack)][3 ounce (pack of 1)][3-ounce (2
|
||
-pack)]
|
||
Bright Citrus Deodorant by Earth Mama | Natural and Safe for
|
||
Sensitive Skin, Pregnancy and Breastfeeding, Contains Organic
|
||
Calendula 3-Ounce
|
||
Price: $10.99
|
||
Rating: N.A.
|
||
[Description]
|
||
[Features]
|
||
[Reviews]
|
||
[Buy Now]
|
||
Action: click[bright citrus]
|
||
Observation: You have clicked bright citrus.
|
||
Action: click[3 ounce (pack of 1)]
|
||
Observation: You have clicked 3 ounce (pack of 1).
|
||
Action: click[Buy Now]
|
||
Action: search
|
||
|
||
3 ounce bright citrus deodorant sensitive skin
|
||
Observation:
|
||
|
||
Back to Search
|
||
|
||
Page 1 (Total results: 50)
|
||
|
||
Next
|
||
|
||
|
||
B078GWRC1J
|
||
|
||
Bright Citrus Deodorant by Earth Mama | Natural and Safe for
|
||
Sensitive Skin, Pregnancy and Breastfeeding, Contains Organic
|
||
Calendula 3-Ounce
|
||
$10.99
|
||
|
||
B078GTKVXY
|
||
|
||
Ginger Fresh Deodorant by Earth Mama | Natural and Safe for
|
||
Sensitive Skin, Pregnancy and Breastfeeding, Contains Organic
|
||
Calendula 3-Ounce
|
||
$10.99
|
||
|
||
B08KBVJ4XN
|
||
|
||
Barrel and Oak - Aluminum-Free Deodorant, Deodorant for Men
|
||
, Essential Oil-Based Scent, 24-Hour Odor Protection, Cedar
|
||
& Patchouli Blend, Gentle on Sensitive Skin (Mountain Sage,
|
||
2.7 oz, 2-Pack)
|
||
$15.95
|
||
Action: think[B078GWRC1J and B078GTKVXY are bright citrus
|
||
deodorant less then 50 dollars. I can check B078GWRC1J first.
|
||
Observation: OK.
|
||
Action: click
|
||
|
||
B078GWRC1J
|
||
|
||
Observation:
|
||
|
||
Back to Search
|
||
|
||
|
||
Prev
|
||
|
||
scent [assorted scents][bright citrus][calming lavender][ginger
|
||
[fresh] simply non-scents]
|
||
size [travel set (4-pack)][3 ounce (pack of 1)][3-ounce (2
|
||
-pack)]
|
||
Bright Citrus Deodorant by Earth Mama | Natural and Safe for
|
||
Sensitive Skin, Pregnancy and Breastfeeding, Contains Organic
|
||
Calendula 3-Ounce
|
||
Price: $10.99
|
||
Rating: N.A.
|
||
[Description]
|
||
[Features]
|
||
[Reviews]
|
||
[Buy Now]
|
||
Action: think[For 3 ounce bottle of bright citrus deodorant
|
||
for sensitive skin, the item has options ’bright citrus’
|
||
and ’3 ounce (pack of 1)’ and seems good to buy.]
|
||
Observation: OK.
|
||
Action: click[bright citrus]
|
||
Observation: You have clicked bright citrus.
|
||
Action: click[3 ounce (pack of 1)]
|
||
Observation: You have clicked 3 ounce (pack of 1).
|
||
Action: click[Buy Now]
|
||
22
|
||
|
||
--- Page 23 ---
|
||
Published as a conference paper at ICLR 2023
|
||
C.4
|
||
ALFWORLD
|
||
Table 7: An Act prompt on the ALFWorld clean task. No thoughts are provided.
|
||
You are in the middle of a room.
|
||
Looking quickly around you, you see a cabinet
|
||
13, a cabinet 12, a cabinet 11, a cabinet 10, a cabinet 9, a cabinet 8, a cabinet
|
||
7, a cabinet 6, a cabinet 5, a cabinet 4, a cabinet 3, a cabinet 2, a cabinet
|
||
1, a coffeemachine 1, a countertop 1, a diningtable 1, a drawer 1, a fridge 1, a
|
||
garbagecan 1, a microwave 1, a shelf 3, a shelf 2, a shelf 1, a sinkbasin 1, a
|
||
stoveburner 4, a stoveburner 3, a stoveburner 2, a stoveburner 1, and a toaster 1.
|
||
Your task is to:
|
||
put a clean lettuce in diningtable.
|
||
> go to fridge 1
|
||
The fridge 1 is closed.
|
||
> open fridge 1
|
||
You open the fridge 1.
|
||
The fridge 1 is open.
|
||
In it, you see a cup 3, a egg 2, a
|
||
potato 3, and a potato 2.
|
||
> go to diningtable 1
|
||
On the diningtable 1, you see a apple 1, a bread 1, a butterknife 2, a cup 2, a
|
||
fork 2, a knife 2, a knife 1, a ladle 1, a lettuce 1, a mug 2, a mug 1, a pan 2, a
|
||
peppershaker 1, a spatula 3, a tomato 2, and a tomato 1.
|
||
> take lettuce 1 from diningtable 1
|
||
You pick up the lettuce 1 from the diningtable 1.
|
||
> go to sinkbasin 1
|
||
On the sinkbasin 1, you see a apple 2, a ladle 2, a spoon 1, and a tomato 3.
|
||
> clean lettuce 1 with sinkbasin 1
|
||
You clean the lettuce 1 using the sinkbasin 1.
|
||
> think:
|
||
Now I clean a lettuce (1).
|
||
Next, I need to put it in/on diningtable 1.
|
||
OK.
|
||
> go to diningtable 1
|
||
On the diningtable 1, you see a apple 1, a bread 1, a butterknife 2, a cup 2, a fork
|
||
2, a knife 2, a knife 1, a ladle 1, a mug 2, a mug 1, a pan 2, a peppershaker 1, a
|
||
spatula 3, a tomato 2, and a tomato 1.
|
||
> put lettuce 1 in/on diningtable 1
|
||
You put the lettuce 1 in/on the diningtable 1.
|
||
23
|
||
|
||
--- Page 24 ---
|
||
Published as a conference paper at ICLR 2023
|
||
Table 8: An ReAct prompt on the ALFWorld clean task.
|
||
You are in the middle of a room.
|
||
Looking quickly around you, you see a cabinet
|
||
13, a cabinet 12, a cabinet 11, a cabinet 10, a cabinet 9, a cabinet 8, a cabinet
|
||
7, a cabinet 6, a cabinet 5, a cabinet 4, a cabinet 3, a cabinet 2, a cabinet
|
||
1, a coffeemachine 1, a countertop 1, a diningtable 1, a drawer 1, a fridge 1, a
|
||
garbagecan 1, a microwave 1, a shelf 3, a shelf 2, a shelf 1, a sinkbasin 1, a
|
||
stoveburner 4, a stoveburner 3, a stoveburner 2, a stoveburner 1, and a toaster 1.
|
||
Your task is to:
|
||
put a clean lettuce in diningtable.
|
||
> think:
|
||
To solve the task, I need to find and take a lettuce, then clean it with
|
||
sinkbasin, then put it in diningtable.
|
||
OK.
|
||
> think:
|
||
First I need to find a lettuce.
|
||
A lettuce is more likely to appear in
|
||
fridge (1), diningtable (1), sinkbasin (1), stoveburner (1-3), cabinet (1-13).
|
||
I
|
||
can check one by one, starting with fridge 1.
|
||
OK.
|
||
> go to fridge 1
|
||
The fridge 1 is closed.
|
||
> open fridge 1
|
||
You open the fridge 1.
|
||
The fridge 1 is open.
|
||
In it, you see a cup 3, a egg 2, a
|
||
potato 3, and a potato 2.
|
||
> go to diningtable 1
|
||
On the diningtable 1, you see a apple 1, a bread 1, a butterknife 2, a cup 2, a
|
||
fork 2, a knife 2, a knife 1, a ladle 1, a lettuce 1, a mug 2, a mug 1, a pan 2, a
|
||
peppershaker 1, a spatula 3, a tomato 2, and a tomato 1.
|
||
> think:
|
||
Now I find a lettuce (1).
|
||
Next, I need to take it.
|
||
OK.
|
||
> take lettuce 1 from diningtable 1
|
||
You pick up the lettuce 1 from the diningtable 1.
|
||
> think:
|
||
Now I take a lettuce (1).
|
||
Next, I need to go to sinkbasin (1) and clean
|
||
it.
|
||
OK.
|
||
> go to sinkbasin 1
|
||
On the sinkbasin 1, you see a apple 2, a ladle 2, a spoon 1, and a tomato 3.
|
||
> clean lettuce 1 with sinkbasin 1
|
||
You clean the lettuce 1 using the sinkbasin 1.
|
||
> think:
|
||
Now I clean a lettuce (1).
|
||
Next, I need to put it in/on diningtable 1.
|
||
OK.
|
||
> go to diningtable 1
|
||
On the diningtable 1, you see a apple 1, a bread 1, a butterknife 2, a cup 2, a fork
|
||
2, a knife 2, a knife 1, a ladle 1, a mug 2, a mug 1, a pan 2, a peppershaker 1, a
|
||
spatula 3, a tomato 2, and a tomato 1.
|
||
> put lettuce 1 in/on diningtable 1
|
||
You put the lettuce 1 in/on the diningtable 1.
|
||
24
|
||
|
||
--- Page 25 ---
|
||
Published as a conference paper at ICLR 2023
|
||
Table 9: An ReAct-IM prompt on the ALFWorld clean task.
|
||
You are in the middle of a room.
|
||
Looking quickly around you, you see a cabinet
|
||
13, a cabinet 12, a cabinet 11, a cabinet 10, a cabinet 9, a cabinet 8, a cabinet
|
||
7, a cabinet 6, a cabinet 5, a cabinet 4, a cabinet 3, a cabinet 2, a cabinet
|
||
1, a coffeemachine 1, a countertop 1, a diningtable 1, a drawer 1, a fridge 1, a
|
||
garbagecan 1, a microwave 1, a shelf 3, a shelf 2, a shelf 1, a sinkbasin 1, a
|
||
stoveburner 4, a stoveburner 3, a stoveburner 2, a stoveburner 1, and a toaster 1.
|
||
Your task is to:
|
||
put a clean lettuce in diningtable.
|
||
> think:
|
||
To solve the task, I need to find and take a lettuce, then clean it with
|
||
sinkbasin, then put it in diningtable.
|
||
OK.
|
||
> think:
|
||
First I need to find a lettuce.
|
||
OK.
|
||
> go to fridge 1
|
||
The fridge 1 is closed.
|
||
> think:
|
||
First I need to find a lettuce.
|
||
OK.
|
||
> open fridge 1
|
||
You open the fridge 1.
|
||
The fridge 1 is open.
|
||
In it, you see a cup 3, a egg 2, a
|
||
potato 3, and a potato 2.
|
||
> think:
|
||
First I need to find a lettuce.
|
||
OK.
|
||
> go to diningtable 1
|
||
On the diningtable 1, you see a apple 1, a bread 1, a butterknife 2, a cup 2, a
|
||
fork 2, a knife 2, a knife 1, a ladle 1, a lettuce 1, a mug 2, a mug 1, a pan 2, a
|
||
peppershaker 1, a spatula 3, a tomato 2, and a tomato 1.
|
||
> think:
|
||
First I need to find a lettuce.
|
||
OK.
|
||
> take lettuce 1 from diningtable 1
|
||
You pick up the lettuce 1 from the diningtable 1.
|
||
> think:
|
||
I need to clean this lettuce (1) using sinkbasin 1.
|
||
OK.
|
||
> go to sinkbasin 1
|
||
On the sinkbasin 1, you see a apple 2, a ladle 2, a spoon 1, and a tomato 3.
|
||
> think:
|
||
I need to clean this lettuce (1) using sinkbasin 1.
|
||
OK.
|
||
> clean lettuce 1 with sinkbasin 1
|
||
You clean the lettuce 1 using the sinkbasin 1.
|
||
> think:
|
||
I need to put this cleaned lettuce (1) in/on diningtable 1.
|
||
OK.
|
||
> go to diningtable 1
|
||
On the diningtable 1, you see a apple 1, a bread 1, a butterknife 2, a cup 2, a fork
|
||
2, a knife 2, a knife 1, a ladle 1, a mug 2, a mug 1, a pan 2, a peppershaker 1, a
|
||
spatula 3, a tomato 2, and a tomato 1.
|
||
> think:
|
||
I need to put this cleaned lettuce (1) in/on diningtable 1.
|
||
OK.
|
||
> put lettuce 1 in/on diningtable 1
|
||
You put the lettuce 1 in/on the diningtable 1.
|
||
D
|
||
TRAJECTORIES
|
||
D.1
|
||
FEVER TRAJECTORIES
|
||
We provide some trajectories produced by ReAct, CoTand Acton several randomly selected exam-
|
||
ples from the FEVER dev set below. Search results are omitted to space.
|
||
25
|
||
|
||
--- Page 26 ---
|
||
Published as a conference paper at ICLR 2023
|
||
Example 2491 (gt: REFUTES)
|
||
ReAct
|
||
Claim:
|
||
Bermuda Triangle is a loosely-defined region in the Pacific Ocean.
|
||
Thought 1:
|
||
I need to search Bermuda Triangle and find if it is in the Pacific Ocean.
|
||
Action 1:
|
||
Search[Bermuda Triangle]
|
||
Observation 1:
|
||
Reportedly haunted locations...
|
||
Thought 2:
|
||
The observation says that it is in the western part of the North Atlantic
|
||
Ocean, so it is not in the Pacific Ocean.
|
||
Action 2:
|
||
Finish[REFUTES]
|
||
Observation 2:
|
||
Episode finished
|
||
Act
|
||
Claim:
|
||
Bermuda Triangle is a loosely-defined region in the Pacific Ocean.
|
||
Action 1
|
||
:
|
||
Search[Bermuda Triangle]
|
||
Observation 1
|
||
:
|
||
Reportedly haunted locations:...
|
||
Action 2:
|
||
Finish[REFUTES]
|
||
Observation 2:
|
||
Episode finished
|
||
CoT
|
||
Claim:
|
||
Bermuda Triangle is a loosely-defined region in the Pacific Ocean.
|
||
Thought:
|
||
Let’s think step by step.
|
||
The Bermuda Triangle is a loosely-defined region
|
||
in the Atlantic Ocean.
|
||
The Pacific Ocean is not the Atlantic Ocean.
|
||
Answer:
|
||
REFUTES
|
||
Example 5908 (gt: SUPPORTS)
|
||
ReAct
|
||
Claim:
|
||
Princess Mononoke is a film.
|
||
Thought 1:
|
||
I need to search Princess Mononoke and find if it is a film.
|
||
Action 1:
|
||
Search[Princess Mononoke]
|
||
Observation 1:
|
||
Princess Mononoke ...
|
||
Thought 2:
|
||
From the observation, it says that Princess Mononoke is a film.
|
||
Action 2:
|
||
Finish[SUPPORTS]
|
||
Observation 2:
|
||
Episode finished
|
||
Act
|
||
Claim:
|
||
Princess Mononoke is a film.
|
||
Action 1:
|
||
Search[Princess Mononoke]
|
||
Observation 1:
|
||
Princess Mononoke ...
|
||
Action 2:
|
||
Finish[SUPPORTS]
|
||
Observation 2:
|
||
Episode finished
|
||
CoT
|
||
Claim:
|
||
Princess Mononoke is a film.
|
||
Thought:
|
||
Let’s think step by step.
|
||
Princess Mononoke is a movie, and movies are
|
||
films.
|
||
Answer:
|
||
SUPPORTS
|
||
Example 1951 (gt: REFUTES)
|
||
ReAct
|
||
Claim:
|
||
Soyuz was part of the American space program.
|
||
Thought 1:
|
||
I need to search Soyuz and find if it was part of the American space
|
||
program.
|
||
Action 1:
|
||
Search[Soyuz]
|
||
Observation 1:
|
||
Soyuz is a transliteration...
|
||
Thought 2:
|
||
It does not mention the American space program, so I need to search
|
||
"American space program" to find if it was part of it.
|
||
Action 2:
|
||
Search[American space program]
|
||
Observation 2:
|
||
The space policy...
|
||
Thought 3:
|
||
It does not mention Soyuz, so I am not sure if this claim is true or not.
|
||
Action 3:
|
||
Finish[NOT ENOUGH INFO]
|
||
Observation 3:
|
||
Episode finished
|
||
Act
|
||
Claim:
|
||
Soyuz was part of the American space program.
|
||
Action 1:
|
||
Search[Soyuz]
|
||
Observation 1:
|
||
Soyuz is a transliteration...
|
||
Action 2:
|
||
Finish[NOT ENOUGH INFO]
|
||
Observation 2:
|
||
Episode finished
|
||
CoT
|
||
Claim:
|
||
Soyuz was part of the American space program.
|
||
Thought:
|
||
Let’s think step by step.
|
||
Soyuz is a Russian spacecraft.
|
||
The American
|
||
space program is NASA. NASA and Russia have worked together on the
|
||
International Space Station.
|
||
Answer:
|
||
SUPPORTS
|
||
26
|
||
|
||
--- Page 27 ---
|
||
Published as a conference paper at ICLR 2023
|
||
Example 3208 (gt: REFUTES)
|
||
ReAct
|
||
Claim:
|
||
Reign Over Me is an American film made in 2010.
|
||
Thought 1:
|
||
I need to search for Reign Over Me and find if it is an American film made
|
||
in 2010.
|
||
Action 1:
|
||
Search[Reign Over Me]
|
||
Observation 1:
|
||
Reign Over Me ...
|
||
Thought 2:
|
||
The observation says that it is an American film made in 2007, so it is not
|
||
made in 2010.
|
||
Action 2:
|
||
Finish[REFUTES]
|
||
Observation 2:
|
||
Episode finished
|
||
Act
|
||
Claim:
|
||
Reign Over Me is an American film made in 2010.
|
||
Action 1:
|
||
Search[Reign Over Me]
|
||
Action 2:
|
||
Finish[SUPPORTS]
|
||
Observation 2:
|
||
Episode finished
|
||
CoT
|
||
Claim:
|
||
Reign Over Me is an American film made in 2010.
|
||
Thought:
|
||
Let’s think step by step.
|
||
First, is Reign Over Me an American film?
|
||
Yes,
|
||
it is.
|
||
Second, was it made in 2010?
|
||
Yes, it was.
|
||
Answer:
|
||
SUPPORTS
|
||
D.2
|
||
ALFWORLD TRAJECTORIES
|
||
We provide an example trajectory of ReAct, Act, and ReAct-IM on the same ALFWorld game,
|
||
pick_clean_then_place_in_recep-Knife-None-CounterTop-10/
|
||
trial_T20190909_110445_675754.
|
||
D.2.1
|
||
REACT TRAJECTORY
|
||
ReAct is able to correctly find the knife, clean it, and then place it on a countertop.
|
||
27
|
||
|
||
--- Page 28 ---
|
||
Published as a conference paper at ICLR 2023
|
||
ReAct ALFWorld trajectory
|
||
You are in the middle of a room.
|
||
Looking quickly around you, you see a cabinet 6, a
|
||
cabinet 5, a cabinet 4, a cabinet 3, a cabinet 2, a cabinet 1, a coffeemachine 1, a
|
||
countertop 3, a countertop 2, a countertop 1, a drawer 3, a drawer 2, a drawer 1, a
|
||
fridge 1, a garbagecan 1, a microwave 1, a shelf 3, a shelf 2, a shelf 1, a sinkbasin
|
||
1, a stoveburner 4, a stoveburner 3, a stoveburner 2, a stoveburner 1, and a toaster
|
||
1.
|
||
Your task is to:
|
||
put a clean knife in countertop.
|
||
> think:
|
||
To solve the task, I need to find and take a knife, then clean it with
|
||
sinkbasin, then put it in countertop.
|
||
OK.
|
||
> think:
|
||
First I need to find a knife.
|
||
A knife is more likely to appear in cabinet
|
||
(1-6), drawer (1-3), countertop (1-3), fridge (1), garbagecan (1), shelf (1-3),
|
||
sinkbasin (1), stoveburner (1-4), toaster (1).
|
||
I can check one by one, starting with
|
||
cabinet 1.
|
||
OK.
|
||
> go to cabinet 1
|
||
On the cabinet 1, you see a bowl 1.
|
||
> go to cabinet 2
|
||
The cabinet 2 is closed.
|
||
> go to cabinet 3
|
||
On the cabinet 3, you see a glassbottle 1.
|
||
> go to cabinet 4
|
||
On the cabinet 4, you see a mug 1.
|
||
> go to cabinet 5
|
||
The cabinet 5 is closed.
|
||
> go to cabinet 6
|
||
The cabinet 6 is closed.
|
||
> go to drawer 1
|
||
The drawer 1 is closed.
|
||
> go to drawer 2
|
||
The drawer 2 is closed.
|
||
> go to drawer 3
|
||
The drawer 3 is closed.
|
||
> go to countertop 1
|
||
On the countertop 1, you see a lettuce 2, a mug 2, a peppershaker 1, and a spoon 2.
|
||
> go to countertop 2
|
||
On the countertop 2, you see a cup 1, a dishsponge 1, a glassbottle 3, a knife 1, a
|
||
plate 2, a potato 3, and a statue 1.
|
||
> think:
|
||
Now I find a knife (1).
|
||
Next, I need to take it.
|
||
OK.
|
||
> take knife 1 from countertop 2
|
||
You pick up the knife 1 from the countertop 2.
|
||
> think:
|
||
Now I take a knife (1).
|
||
Next, I need to go to sinkbasin (1) and clean it.
|
||
OK.
|
||
> go to sinkbasin 1
|
||
On the sinkbasin 1, you see a fork 3, a lettuce 3, and a spatula 2.
|
||
> clean knife 1 with sinkbasin 1
|
||
You clean the knife 1 using the sinkbasin 1.
|
||
> think:
|
||
Now I clean a knife (1).
|
||
Next, I need to put it in/on countertop 1.
|
||
OK.
|
||
> go to countertop 1
|
||
On the countertop 1, you see a lettuce 2, a mug 2, a peppershaker 1, and a spoon 2.
|
||
> put knife 1 in/on countertop 1
|
||
You put the knife 1 in/on the countertop 1.
|
||
D.2.2
|
||
ACT TRAJECTORY
|
||
Act is able to correctly find the knife, but tries to clean it using a sinkbasin before actually going
|
||
to the sinkbasin. From there on, the model is unable to recover, and is stuck repeating the same
|
||
sequence of commands. With ReAct, an existing thought would have concretely identified that the
|
||
knife had been taken, and that the next subgoal was to go to a sinkbasin to clean it.
|
||
28
|
||
|
||
--- Page 29 ---
|
||
Published as a conference paper at ICLR 2023
|
||
Act ALFWorld trajectory
|
||
You are in the middle of a room.
|
||
Looking quickly around you, you see a cabinet 6, a
|
||
cabinet 5, a cabinet 4, a cabinet 3, a cabinet 2, a cabinet 1, a coffeemachine 1, a
|
||
countertop 3, a countertop 2, a countertop 1, a drawer 3, a drawer 2, a drawer 1, a
|
||
fridge 1, a garbagecan 1, a microwave 1, a shelf 3, a shelf 2, a shelf 1, a sinkbasin
|
||
1, a stoveburner 4, a stoveburner 3, a stoveburner 2, a stoveburner 1, and a toaster
|
||
1.
|
||
Your task is to:
|
||
put a clean knife in countertop.
|
||
> go to countertop 1
|
||
On the countertop 1, you see a lettuce 2, a mug 2, a peppershaker 1, and a spoon 2.
|
||
> go to countertop 2
|
||
On the countertop 2, you see a cup 1, a dishsponge 1, a glassbottle 3, a knife 1, a
|
||
plate 2, a potato 3, and a statue 1.
|
||
> take knife 1 from countertop 2
|
||
You pick up the knife 1 from the countertop 2.
|
||
> go to countertop 1
|
||
On the countertop 1, you see a lettuce 2, a mug 2, a peppershaker 1, and a spoon 2.
|
||
> clean knife 1 with sinkbasin 1
|
||
Nothing happens.
|
||
> go to countertop 3
|
||
On the countertop 3, you see a bread 3, a butterknife 2, a cellphone 1, a creditcard
|
||
1, a fork 2, a houseplant 1, a knife 2, a spatula 1, a statue 3, a tomato 3, a tomato
|
||
2, a tomato 1, and a vase 2.
|
||
> take knife 2 from countertop 3
|
||
Nothing happens.
|
||
> go to countertop 2
|
||
On the countertop 2, you see a cup 1, a dishsponge 1, a glassbottle 3, a plate 2, a
|
||
potato 3, and a statue 1.
|
||
> take knife 1 from countertop 2
|
||
Nothing happens.
|
||
> go to countertop 1
|
||
On the countertop 1, you see a lettuce 2, a mug 2, a peppershaker 1, and a spoon 2.
|
||
> clean knife 1 with sinkbasin 1
|
||
Nothing happens.
|
||
> go to countertop 3
|
||
On the countertop 3, you see a bread 3, a butterknife 2, a cellphone 1, a creditcard
|
||
1, a fork 2, a houseplant 1, a knife 2, a spatula 1, a statue 3, a tomato 3, a tomato
|
||
2, a tomato 1, and a vase 2.
|
||
> take knife 2 from countertop 3
|
||
Nothing happens.
|
||
> go to countertop 2
|
||
On the countertop 2, you see a cup 1, a dishsponge 1, a glassbottle 3, a plate 2, a
|
||
potato 3, and a statue 1.
|
||
> take knife 1 from countertop 2
|
||
Nothing happens.
|
||
> go to countertop 1
|
||
On the countertop 1, you see a lettuce 2, a mug 2, a peppershaker 1, and a spoon 2.
|
||
> clean knife 1 with sinkbasin 1
|
||
Nothing happens.
|
||
> go to countertop 3
|
||
On the countertop 3, you see a bread 3, a butterknife 2, a cellphone 1, a creditcard
|
||
1, a fork 2, a houseplant 1, a knife 2, a spatula 1, a statue 3, a tomato 3, a tomato
|
||
2, a tomato 1, and a vase 2.
|
||
> take knife 2 from countertop 3
|
||
Nothing happens.
|
||
> go to countertop 2
|
||
On the countertop 2, you see a cup 1, a dishsponge 1, a glassbottle 3, a plate 2, a
|
||
potato 3, and a statue 1.
|
||
> take knife 1 from countertop 2
|
||
Nothing happens.
|
||
> go to countertop 1
|
||
On the countertop 1, you see a lettuce 2, a mug 2, a peppershaker 1, and a spoon 2.
|
||
> clean knife 1 with sinkbasin 1
|
||
Nothing happens.
|
||
D.2.3
|
||
REACT-IM TRAJECTORY
|
||
ReAct-IM is able to correctly find the knife, but is unable to clean it as well. The LLM then
|
||
gets stuck trying to place this knife on a countertop. One possible issue is the incorrect thought
|
||
think:
|
||
I need to find a clean knife., which seems to trick the LLM in believing
|
||
that the knife is already cleaned. In ReAct, this sequence of subgoals would be concretely captured
|
||
by each thought.
|
||
29
|
||
|
||
--- Page 30 ---
|
||
Published as a conference paper at ICLR 2023
|
||
ReAct-IM ALFWorld trajectory
|
||
You are in the middle of a room.
|
||
Looking quickly around you, you see a cabinet 6, a
|
||
cabinet 5, a cabinet 4, a cabinet 3, a cabinet 2, a cabinet 1, a coffeemachine 1, a
|
||
countertop 3, a countertop 2, a countertop 1, a drawer 3, a drawer 2, a drawer 1, a
|
||
fridge 1, a garbagecan 1, a microwave 1, a shelf 3, a shelf 2, a shelf 1, a sinkbasin
|
||
1, a stoveburner 4, a stoveburner 3, a stoveburner 2, a stoveburner 1, and a toaster
|
||
1.
|
||
Your task is to:
|
||
put a clean knife in countertop.
|
||
> think:
|
||
To solve the task, I need to find and take a clean knife, then put it in
|
||
countertop.
|
||
OK.
|
||
> think:
|
||
I need to find a clean knife.
|
||
OK.
|
||
> go to countertop 1
|
||
On the countertop 1, you see a lettuce 2, a mug 2, a peppershaker 1, and a spoon 2.
|
||
> think:
|
||
I need to find a clean knife.
|
||
OK.
|
||
> go to countertop 2
|
||
On the countertop 2, you see a cup 1, a dishsponge 1, a glassbottle 3, a knife 1, a
|
||
plate 2, a potato 3, and a statue 1.
|
||
> think:
|
||
I need to find a clean knife.
|
||
OK.
|
||
> take knife 1 from countertop 2
|
||
You pick up the knife 1 from the countertop 2.
|
||
> think:
|
||
I need to put this knife (1) in/on countertop 1.
|
||
OK.
|
||
> go to countertop 1
|
||
On the countertop 1, you see a lettuce 2, a mug 2, a peppershaker 1, and a spoon 2.
|
||
> think:
|
||
I need to put this knife (1) in/on countertop 1.
|
||
OK.
|
||
> put knife 1 in/on countertop 1
|
||
You put the knife 1 in/on the countertop 1.
|
||
> think:
|
||
I need to put this knife (1) in/on countertop 1.
|
||
OK.
|
||
> put knife 1 in/on countertop 1
|
||
Nothing happens.
|
||
> think:
|
||
I need to put this knife (1) in/on countertop 1.
|
||
OK.
|
||
> put knife 1 in/on countertop 1
|
||
Nothing happens.
|
||
> think:
|
||
I need to put this knife (1) in/on countertop 1.
|
||
OK.
|
||
> put knife 1 in/on countertop 1
|
||
Nothing happens.
|
||
> think:
|
||
I need to put this knife (1) in/on countertop 1.
|
||
OK.
|
||
> put knife 1 in/on countertop 1
|
||
Nothing happens.
|
||
> think:
|
||
I need to put this knife (1) in/on countertop 1.
|
||
OK.
|
||
> put knife 1 in/on countertop 1
|
||
Nothing happens.
|
||
> think:
|
||
I need to put this knife (1) in/on countertop 1.
|
||
OK.
|
||
30
|
||
|
||
--- Page 31 ---
|
||
Published as a conference paper at ICLR 2023
|
||
D.3
|
||
WEBSHOP TRAJECTORIES
|
||
Table 10: Example trajectories for Webshop predicted by Act and ReAct. Compared to Act,
|
||
ReAct uses reasoning to find products that satisfy all target attributes.
|
||
Instruction: get me a sixteen pack of apple cinnamon freeze dried banana chips, and price lower than 50.00 dollars
|
||
Act
|
||
ReAct
|
||
Action: search
|
||
|
||
sixteen pack apple cinnamon freeze dried banana
|
||
chips
|
||
|
||
Observation:
|
||
|
||
Back to Search
|
||
|
||
Page 1 (Total results: 50)
|
||
|
||
Next
|
||
|
||
|
||
B0061IVFZE
|
||
|
||
Brothers-ALL-Natural Fruit Crisps, Strawberry Banana, 0.42 -
|
||
Ounce (Pack of 100)
|
||
$85.0
|
||
|
||
B096H2P6G2
|
||
|
||
Moon Fruit Freeze Dried Fruit Snacks. Fruit Snacks for Kids -
|
||
(Variety Pack)
|
||
$18.99
|
||
|
||
B092JLLYK6
|
||
|
||
Nature’s Turn Freeze-Dried Fruit Snacks - Banana Crisps - Perfect
|
||
For School Lunches or an On-The-Go Snack - No Sugar Added,
|
||
Non GMO, Gluten Free, Nothing Artificial (0.53oz) 6-Pack
|
||
$12.99
|
||
Action: click
|
||
|
||
B0061IVFZE
|
||
|
||
Observation:
|
||
|
||
Back to Search
|
||
|
||
|
||
Prev
|
||
|
||
flavor name [asian pear][banana][fuji apple & cinnamon][strawberry
|
||
banana] Brothers-ALL-Natural Fruit Crisps, Strawberry Banana,
|
||
0.42 Ounce (Pack of 100)
|
||
Price: $85.0
|
||
Rating: N.A.
|
||
[Description]
|
||
[Features]
|
||
[Reviews]
|
||
[Buy Now]
|
||
Action: click[Buy Now]
|
||
Action: search
|
||
|
||
sixteen pack apple cinnamon freeze dried banana
|
||
chips
|
||
|
||
Observation:
|
||
|
||
Back to Search
|
||
|
||
Page 1 (Total results: 50)
|
||
|
||
Next
|
||
|
||
|
||
B0061IVFZE
|
||
|
||
Brothers-ALL-Natural Fruit Crisps, Strawberry Banana, 0.42 -
|
||
Ounce (Pack of 100)
|
||
$85.0
|
||
|
||
B096H2P6G2
|
||
|
||
Moon Fruit Freeze Dried Fruit Snacks. Fruit Snacks for Kids -
|
||
(Variety Pack)
|
||
$18.99
|
||
|
||
B092JLLYK6
|
||
|
||
Nature’s Turn Freeze-Dried Fruit Snacks - Banana Crisps - Perfect
|
||
For School Lunches or an On-The-Go Snack - No Sugar Added,
|
||
Non GMO, Gluten Free, Nothing Artificial (0.53oz) 6-Pack
|
||
$12.99
|
||
Action: think[B0061IVFZE is strawberry banana, not apple cinnamon.
|
||
B096H2P6G2 is fruit snacks, not freeze dried banana chips.
|
||
B092JLLYK6 is banana crisps, not apple cinnamon. I can check
|
||
B092JLLYK6 first.
|
||
Observation: OK.
|
||
Action: click
|
||
|
||
B092JLLYK6
|
||
|
||
Observation:
|
||
|
||
Back to Search
|
||
|
||
|
||
Prev
|
||
|
||
flavor name [apple][apple cinnamon][banana][cantaloupe][peach][pear]
|
||
[strawberry][strawberry banana][sampler variety pack][mega variety
|
||
pack][orchard variety pack]
|
||
size [0.53 ounce (pack of 6)][0.53 ounce (pack of 8)][0.53 ounce (pack
|
||
of 16)]
|
||
Nature’s Turn Freeze-Dried Fruit Snacks - Banana Crisps - Perfect
|
||
For School Lunches or an On-The-Go Snack - No Sugar Added, Non
|
||
GMO, Gluten Free, Nothing Artificial (0.53oz) 6-Pack
|
||
Price: $12.99
|
||
Rating: N.A.
|
||
[Description]
|
||
[Features]
|
||
[Reviews]
|
||
[Buy Now]
|
||
Action: think[For sixteen pack of apple cinnamon freeze dried banana
|
||
chips, the item has options ’apple cinnamon’ and ’0.53 ounce (pack of
|
||
16)’ and seems good to buy.]
|
||
Observation: OK.
|
||
Action: click[apple cinnamon]
|
||
Observation: You have clicked apple cinnamon.
|
||
Action: click[0.53 ounce (pack of 16)]
|
||
Observation: You have clicked 0.53 ounce (pack of 16).
|
||
Action: click[Buy Now]
|
||
Score: 0.125
|
||
Score: 1.0
|
||
31
|
||
|
||
--- Page 32 ---
|
||
Published as a conference paper at ICLR 2023
|
||
E
|
||
MORE ANALYSIS
|
||
E.1
|
||
SUCCESS AND FAILURE MODES ANALYSIS
|
||
We provide some examples corresponding to the success and error mode analysis given in Sec. 3.3.
|
||
Search results and non-representative steps are omitted to reduce space.
|
||
Success: True positive
|
||
ReAct
|
||
Question:
|
||
Author David Chanoff has collaborated with a U.S. Navy admiral who served as
|
||
the ambassador to the United Kingdom under which President?
|
||
Thought 1:
|
||
I need to search David Chanoff and find the U.S. Navy admiral he
|
||
collaborated with.
|
||
Action 1:
|
||
Search[David Chanoff]
|
||
Observation 1:
|
||
David Chanoff is a noted author...
|
||
Action 2:
|
||
Search[William J. Crowe]
|
||
Observation 2:
|
||
William J. Crowe is...
|
||
Thought 3:
|
||
William J. Crowe served as the ambassador to the United Kingdom under
|
||
President Bill Clinton.
|
||
So the answer is Bill Clinton.
|
||
Action 3:
|
||
Finish[Bill Clinton]
|
||
Observation 3:
|
||
Episode finished
|
||
CoT
|
||
Question:
|
||
What was the name of the team that represented an Arizona university in
|
||
the conference that covers a broad expanse of the western United States,
|
||
including Arizona, California, and New Mexico?
|
||
Thought:
|
||
Let’s think step by step.
|
||
The name of the team that represented an Arizona
|
||
university in the conference that covers a broad expanse of the western
|
||
United States, including Arizona, California, and New Mexico is Arizona
|
||
State Sun Devils.
|
||
Answer:
|
||
Arizona State Sun Devils
|
||
Success: False positive
|
||
ReAct
|
||
Question:
|
||
Did the board game San Marco or About Time come out first?
|
||
Thought 1:
|
||
I need to search San Marco and About Time, and find which came out first.
|
||
Action 1:
|
||
Search[San Marco]
|
||
Observation 1:
|
||
San Marco is one of the ...
|
||
The was built in venice.
|
||
Thought 2:
|
||
San Marco is a sestiere of Venice.
|
||
I need to search About Time next.
|
||
Action 2:
|
||
Search[About Time]
|
||
Observation 2:
|
||
Could not find [About Time].
|
||
Similar:
|
||
[...].
|
||
Thought 3:
|
||
About Time is a 2013 film.
|
||
So San Marco came out first.
|
||
Action 3:
|
||
Finish[San Marco]
|
||
Observation 3:
|
||
Episode finished
|
||
CoT
|
||
Question:
|
||
Was Vanderbilt University or Emory University founded first?
|
||
Thought:
|
||
Let’s think step by step.
|
||
Vanderbilt University was founded in 1873.
|
||
Emory
|
||
University was founded in 1836.
|
||
1873 (Vanderbilt University) > 1836 (Emory
|
||
University), so Vanderbilt University was founded first.
|
||
Answer:
|
||
Emory University
|
||
Failure: Reasoning error
|
||
ReAct
|
||
Question:
|
||
What was the middle name of the actress who was cast alongside Harvey
|
||
Fierstein, Linda Hart, Dick Latessa, Clarke Thorell, Mary Bond Davis, Laura
|
||
Bell Bundy, Matthew Morrison, Corey Reynolds, and Marissa Jaret Winokur in
|
||
Hairspray?
|
||
Thought 1:
|
||
I need to search Harvey Fierstein, Linda Hart, Dick Latessa, Clarke Thorell,
|
||
Mary Bond Davis, Laura Bell Bundy, Matthew Morrison, Corey Reynolds, and
|
||
Marissa Jaret Winokur, find the actress that was cast alongside them in
|
||
Hairspray, then find its middle name.
|
||
Action 1:
|
||
Search[Harvey Fierstein]
|
||
Observation 1:
|
||
Harvey Forbes Fierstein ...
|
||
Thought 2:
|
||
Harvey Fierstein is an actor, playwright, and screenwriter.
|
||
I need to
|
||
search Linda Hart next...
|
||
Action 2:
|
||
Search[Linda Hart]...
|
||
CoT
|
||
Question:
|
||
Who is older Danny Green or James Worthy?
|
||
Thought:
|
||
Let’s think step by step.
|
||
Danny Green was born in 1987.
|
||
James Worthy was
|
||
born in 1961.
|
||
1987 (Danny Green) > 1961 (James Worthy), so Danny Green is
|
||
older.
|
||
Answer:
|
||
Danny Green
|
||
32
|
||
|
||
--- Page 33 ---
|
||
Published as a conference paper at ICLR 2023
|
||
Failure: Search error
|
||
ReAct
|
||
Question:
|
||
What does the goddess associated with the goddess frigg consists of what
|
||
tales?
|
||
Thought 1:
|
||
I need to search goddess frigg and find its associated goddess.
|
||
Action 1:
|
||
Search[goddess frigg]
|
||
Observation 1:
|
||
Could not find goddess frigg.
|
||
Similar:
|
||
[’Frigg’, ’Frigg and Freyja common
|
||
origin hypothesis’, ’Freyja (section Relation to Frigg and other goddesses
|
||
and figures)’, ’Eir (redirect from Eir (goddess))’, ’Baldr’].
|
||
Thought 2:
|
||
I need to search Frigg instead...
|
||
Failure: Hallucination
|
||
CoT
|
||
Question:
|
||
What was the first year a scientific journal published by an organization
|
||
located in the Bronx was published?
|
||
Thought:
|
||
Let’s think step by step.
|
||
The first year a scientific journal published by
|
||
an organization located in the Bronx was published was 1916.
|
||
Answer:
|
||
1916 (Label:
|
||
1909)
|
||
Failure: Label ambiguity
|
||
ReAct
|
||
Question:
|
||
What nationality is the man who developed the dictator game?
|
||
Thought 1:
|
||
I need to search dictator game, find the man who developed it, then find his
|
||
nationality.
|
||
Action 1:
|
||
Search[dictator game]
|
||
Observation 1:
|
||
The dictator game is a popular experimental instrument in social psychology
|
||
and economics...
|
||
Action 3:
|
||
Search[Amos Tversky]
|
||
Observation 3:
|
||
Amos Nathan Tversky...
|
||
Thought 4:
|
||
Amos Tversky is an Israeli cognitive and mathematical psychologist.
|
||
So the
|
||
man who developed the dictator game is Israeli.
|
||
Action 4:
|
||
Finish[Israeli] (label:
|
||
Israel-American)
|
||
CoT
|
||
Question:
|
||
Kurt Fuller from Stockton, CA appeared in which American Detective Comedy
|
||
Drama television series created by Steve Franks?
|
||
Thought:
|
||
Let’s think step by step.
|
||
Kurt Fuller from Stockton, CA appeared in Psych.
|
||
Psych is an American Detective Comedy Drama television series created by
|
||
Steve Franks.
|
||
Answer:
|
||
Psych (label:
|
||
Psych is an American detective comedy-drama)
|
||
33
|